alaskacremation.com
Home :: Cremation Society of Alaska
Learn About the Society. Our Cremation Code of Ethics. In a few steps, plan and pay online. Join Now. Plan Later. Learn about the Society. May 22, 2015. May 21, 2015. May 16, 2015. May 16, 2015. May 05, 2015. May 02, 2015. May 02, 2015. Apr 27, 2015. Apr 25, 2015. Apr 25, 2015. Apr 25, 2015. Apr 25, 2015. Cremation Society of Alaska. 7216 Lake Otis Parkway. Anchorage, Alaska 99507. Cremation Society of Alaska. 5050 E. Dunbar Drive. Wasilla, Alaska 99654.
alaskacremationsociety.com
www.alaskacremationsociety.com
This site is under construction. Why am I seeing this page? Are you the owner of this domain? How to replace this page. Try these searches related to www.alaskacremationsociety.com:. Chapel of the Pine. Cremation Society of Minnesota. Cremation Society of Georgia.
alaskacrew.org
Site Unavailable
This site is currently unavailable.
alaskacrewlynx.com
Alaska Crewlynx LLC - Home
Your Global Express Crewing and Management Solution. Is crew swapping in Alaska or Canada becoming a time-consuming and expensive option for your Global Express operations? Consider letting Alaska Crewlynx solve this and any other crewing or management needs for your Global Express. I am a highly experienced Global Express Captain with worldwide operational background, whether you are looking for a relief Captain or third / augment pilot, either in Alaska, Canada or anywhere on the globe the need exists.
alaskacrewtransporters.com
Alaska Crew Transporters - Crew carrier buses separate cargo storage
Wildland Fire Crew Carrier Buses. We're not just another school bus. Our best value crew carrier buses have gear separation cages and compartments to transport forest fire fighters and their equipment. A chase truck is not necessary to send a crew and their fireline gear to an incident. Save time, money, paperwork. And fewer inspections for chase trucks by giving us a call at 907-259-5311. We commit to being available 24 - 7. Find us on OLAS! Alaskan owned and operated. Find us on OLAS.
alaskacriminaldefenseattorneys.com
Alaska Criminal Defense Attorneys - Home
Alaska Criminal Defense Attorneys Find the most qualified Cirminal Defense Attorneys. Jump to main navigation and login. Alaska Criminal Defense Attorneys. Find Alaska Criminal Defense Attorneys. Alaska Criminal Defense Attorneys. Published on Friday, 27 September 2013 19:51. Written by Super User. Alaska Criminal Defense Attorneys website can help you find the most qualified Attorneys. Please fill out the forms and an attorney will contact you soon.
alaskacriminaldefenselawyerattorney.com
Alaska Criminal Defense Lawyers and Attorneys
Criminal Defense HelpLine: 866-757-6949. 8211; Main Menu –. Criminal Defense Practice Area. PCS Drug Possession Defense. Hit and Run Defense. Internet Sex Crimes Defense. Felon in Possession Defense. Unlawful Possession of Firearm Defense. Receiving Stolen Property Defense. White Collar Crimes Defense. Credit Card Fraud Defense. Other Area of Law. Accessory to Crime Defense. Aiding & Abetting Defense. Criminal Defense Practice Area. PCS Drug Possession Defense. Hit and Run Defense. Other Area of Law.
alaskacriminaljusticeschools.com
Site Unavailable
This site is currently unavailable.