themeekshall.co.uk

blog.juliendecaudin.com

duck – Julien Decaudin

http://blog.juliendecaudin.com/tag/duck

September 2nd, 2013. Shortly after completing my Penarth View cover illustration Penarth Pier Pavilion. Asked me to illustrate the newly refurbished Pavilion, along with two other talented local illustrators, Matt Joyce. Continue reading Penarth Pier Pavilion. August 22nd, 2012. I’m into drawing ducks. But mostly tiny ones so I needed a big one. His name is Duck and he’s got a lady friend, Lady Duck. Together they happily fly pretty high. Continue reading High fly. April 5th, 2012. June 10th, 2011. My de...

loudpoet.com

Military – Guy LeCharles Gonzalez

http://loudpoet.com/tags/military

How I Could Just Kill a (Virtual) Man. By Guy LeCharles Gonzalez. March 12, 2015. Mozer, Bethea and Me (for Veteran’s Day). By Guy LeCharles Gonzalez. November 11, 2013. By Guy LeCharles Gonzalez. May 25, 2009. Take a moment today to remember those who died, and those who came back less than whole. It’s not just a long weekend, and it has nothing to do with politics. Like Hope, But Different. By Guy LeCharles Gonzalez. February 11, 2008. Youtube:http:/ www.youtube.com/watch? By Guy LeCharles Gonzalez.

defydesignsvsmichaelpartridge.blogspot.com

Defy Designs vs Michael Partridge: November 2010

http://defydesignsvsmichaelpartridge.blogspot.com/2010_11_01_archive.html

Tuesday, 30 November 2010. This was one of those random little jobs, a friend of mine had asked me for some advice on font types, I tried my best but wasn't sure what he meant. A few days later I saw why he needed it and then for little or no reason I decided to do what I thought he wanted. I've seen fonts that are similar to this, but I decided to just do it myself and make it more how I wanted it to look. Lets face facts, thats what I'm supposed to do right? CDF RVW on twitter. It's been a while. Poste...

defydesignsvsmichaelpartridge.blogspot.com

Defy Designs vs Michael Partridge: There was a time...

http://defydesignsvsmichaelpartridge.blogspot.com/2011/07/there-was-time.html

Friday, 15 July 2011. There was a time. In my life when if I was asked, "Can you make us a website? Part of me would have shriveled up and died! Now I actually seem to enjoy it! What happened to me? I think I caught a strange disease. After my success with the anti-myspace web site for Mike Borgia, I put the word out that I was on the hunt for anyone else who was interested, Richard from They Walk Among Us got back to me first! I really like the side menu and logo header. See it in action. Or even ideas ...

defydesignsvsmichaelpartridge.blogspot.com

Defy Designs vs Michael Partridge: Myspace is dead...

http://defydesignsvsmichaelpartridge.blogspot.com/2011/07/myspace-is-dead.html

Friday, 15 July 2011. And it has been for a long time. Yet somehow no site has really managed to fill the void it left, there are a few that are coming close, but not quite managing to do the whole nine yards. So when I got into a conversation about what the solution to the lacking of a myspace was, I got my thinking cap on. So the plan was to make a site that had next to no content stored on servers and was auto updated via some/all of these external sources! See it in action. Posted by Michael Partridge.

defydesignsvsmichaelpartridge.blogspot.com

Defy Designs vs Michael Partridge: Personal projects rock!

http://defydesignsvsmichaelpartridge.blogspot.com/2011/07/personal-projects-rock.html

Wednesday, 20 July 2011. It's a great way to exercise that corner of your creative mind that doesn't get the work out it needs very often. This project was started by a bizarre conversation about bad celebrity endorsements (John Lydon and butter! And the idea that some celeb's should have signature products! The only downside of this conversation was, the funny ideas were/are a little politically incorrect. I decided that it would be interesting to try brand a few of these ridiculous products. Awesome de...

halfblog.net

Geo-writing: ‘A Boat called Calamity’ | halfblog.net

https://halfblog.net/2014/10/01/geo-writing

Things that amuse and confuse me. Skip to primary content. The Campaign Against Crap Infographics. Geo-writing: ‘A Boat called Calamity’. This year as a part of the Brighton Digital Festival. Encouraged to participate in the Geo-writing. Geo-Writing invited you to grab writing prompts based on your location, wherever you were in the world! My entry is written in the style of an Argus. Story and inspired by a prompt I found near West Pier:. About a Kemptown overrun by zombies known as. While it is unknown...

halfblog.net

WordPress.com | halfblog.net

https://halfblog.net/tag/wordpress-com

Things that amuse and confuse me. Skip to primary content. Skip to secondary content. The Campaign Against Crap Infographics. Tag Archives: WordPress.com. Visitors to this blog may notice that the domain is now foomandoonian.wordpress.com. And not halfblog.net. As they were expecting (and as advertised in the banner above). My plan — for those who care — is to eventually revamp my geoff.at. If I ever decide to pay for WordPress Premium again, I’ll probably put the money into that blog. It&#8217...We’ve d...

halfblog.net

Brighton Digital Festival | halfblog.net

https://halfblog.net/2014/08/15/brighton-digital-festival-2014

Things that amuse and confuse me. Skip to primary content. The Campaign Against Crap Infographics. All next month will be. First Brighton Digital Festival. Today I’ve been looking through all of the events, and. Is there ever a lot happening! I created a list of the ones that interested me the most and I’m blogging it here because why not? Ongoing / multiple day events. Mind of the City. 1–30 Sept, 3:38pm. Place TBC (possibly multiple locations). The New Digital Archaeologists. An installation that invit...

halfblog.net

Explore this blog… | halfblog.net

https://halfblog.net/explore

Things that amuse and confuse me. Skip to primary content. The Campaign Against Crap Infographics. Explore this blog by jumping to a particular month or year. LEGO timelapse: Building Curiosity. Does Internet advertising work at all? USS Pioneer: These are the voyages of a LightWave starship model I released. Geo-writing: ‘A Boat called Calamity’. Looking for nothing in particular? Try a random post. Visitors to this blog may notice that the domain is now foomandoonian.wordpress.com. Blog and import the ...