Look no further than KingFisher’s Alaskan Malamutes for your next Giant Alaskan Malamute Dog or Puppy. Contact us today to learn more - 907-841-8171
http://www.alaskamalamutepuppies.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
1 seconds
Kings fishers Perch
po ●●●112
Ga●●na , AK, 99586
US
View this contact
Kings fishers Perch
Kings fishers Perch
po ●●●112
Ga●●na , AK, 99586
US
View this contact
Kings fishers Perch
Kings fishers Perch
po ●●●112
Ga●●na , AK, 99586
US
View this contact
BUY YOUR DOMAIN
13
YEARS
6
MONTHS
14
DAYS
NETWORK SOLUTIONS, LLC.
WHOIS : whois.networksolutions.com
REFERRED : http://networksolutions.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
2
SITE IP
64.78.222.2
LOAD TIME
0.976 sec
SCORE
6.2
Alaskan Malamute Breeder & Puppies for Sale from KingFishers Alaskan Malamutes | alaskamalamutepuppies.com Reviews
https://alaskamalamutepuppies.com
Look no further than KingFisher’s Alaskan Malamutes for your next Giant Alaskan Malamute Dog or Puppy. Contact us today to learn more - 907-841-8171
alaskamalamutepuppies.com
Young Adults | KingFishers Alaskan Malamutes
http://www.alaskamalamutepuppies.com/category/young-adults
PO Box 521848 Big Lake, AK 99652. Bristol & River Puppies. Tundra 9 Yr old Female. August 21, 2015. Please contact us local to Alaska Only $100.00. Posted in Young Adults. We have some Available. December 22, 2013. We have some really awesome Adults looking for new homes please contact us ASAP! 907)-982-8886 ( Monica Cell). Posted in Young Adults. Tundra 9 Yr old Female. Would You Like To Receive Emails From us in the Future? This field is for validation purposes and should be left unchanged.
Nikiski & Ruckus | KingFishers Alaskan Malamutes
http://www.alaskamalamutepuppies.com/category/nikiski-ruckus
PO Box 521848 Big Lake, AK 99652. Bristol & River Puppies. Viewing: Nikiski and Ruckus. January 28, 2015. Cherish Red and White Closed Face SOLD. Beautiful girl with a Fantastic head! Posted in Nikiski and Ruckus. January 28, 2015. Ruby Red Female SOLD. You Can Absolutely Not Go wrong with This Girl! Posted in Nikiski and Ruckus. January 28, 2015. Arrow Red and White Closed Face Male SOLD. Posted in Nikiski and Ruckus. Tundra 9 Yr old Female. Would You Like To Receive Emails From us in the Future?
Giant Alaskan Malamute Puppy Breeder | KingFishers Alaskan Malamutes
http://www.alaskamalamutepuppies.com/category/our_mals/past-puppies
PO Box 521848 Big Lake, AK 99652. Bristol & River Puppies. Puppies from our past litters. March 19, 2013. This big boy is the son of Kima and River! Get your deposit in soon if you would like to have a Giant Gray like “Buster” here! Posted in Past Puppies. March 5, 2013. Now living in AZ she is living the good life in the land of no snow. Alaskan Malamutes do fine in warmer weather, and as long as their treated like any mammal and given water, food, and shelter they will thrive. Posted in Past Puppies.
Giant Alaskan Malamute Puppies for Sale & Adoption | KingFishers Alaskan Malamutes
http://www.alaskamalamutepuppies.com/new-litters
PO Box 521848 Big Lake, AK 99652. Bristol & River Puppies. Available Alaskan Malamute Puppies for Sale. There are new litters of puppies being born all the time! The Giant Alaskan Malamute normally has a litter of 5-9 puppies. To see the litters that we have available right now click on the different litters at the side nav. or under the drop down on available puppies. Tundra 9 Yr old Female. Would You Like To Receive Emails From us in the Future? Bristol & River Puppies. PO Box 521848 Big Lake, AK 99652.
Bristol & River Puppies | KingFishers Alaskan Malamutes
http://www.alaskamalamutepuppies.com/category/bristol-river-puppies
PO Box 521848 Big Lake, AK 99652. Bristol & River Puppies. Viewing: Bristol and River Puppies. July 29, 2016. Well this sweet heart is Bronze and Brains she is big and beautiful! Posted in Bristol and River Puppies. July 29, 2016. This little one is any thing but Taboo, Everyone will be talking about how simply amazing this dog is! Posted in Bristol and River Puppies. July 29, 2016. Posted in Bristol and River Puppies. July 29, 2016. Posted in Bristol and River Puppies. July 29, 2016. July 29, 2016.
TOTAL PAGES IN THIS WEBSITE
20
Alaska Dog Breeders
http://www.dogbreederdirectory.com/breeders/AK/1
Looking for a dog breeder in Alaska? Simply browse through our nationwide directory. Of over 8000 dog breeders - complete with website addresses, dog breed profiles, and current puppies for sale. Cavalier King Charles Spaniel. We are just your next door neighbor type of breeders.Our puppies are born and. Raised inside our home so they are used to everyday noises. Big Lake, AK. Http:/ www.alaskamalamutepuppies.com. Our desire is to breed quality dogs and produce quality puppies.Malamutes are. We are a sma...
TOTAL LINKS TO THIS WEBSITE
2
-АЛЯСКИНСКИЙ МАЛАМУТ-ЩЕНКИ-ВЯЗКА-РАЗВЕДЕНИЕ / Alaskan malamutes
Аляскинский маламут - ближайший родственник сибирского хаски, хотя это совсем разные породы, несмотря, что они очень похожи и не всегда не специалист может их различить. Порода Аляскинский маламут берёт начало с берега залива Коцебу, который является частью Беренгова пролива. Пик развития породы пришёлся на времена "Золотой лихорадки". С 1926 года породой занимаются профессиональные кинологи. Видео с нашими маламутами. Красивая и дальше только плюсы и синонимы. Маламут - это любовь с первого взгляда!
Аляскинские маламуты, шиба-ину, кламбер-спаниели : питомник Айрон Айс Ирины Сторожковой
Ваш верный друг ждёт Вас! Аляскинский маламут IRON ICE AMADEY MOTSART. HELSINKI WINNER - Финляндия 2013! 13 декабря 2013 г., Хельсинки. Класс чемпионов, CACIB, Sert, ЛУЧШИЙ КОБЕЛЬ, Helsinki Winner. Судья - Klaus Strack, Germani. Хендлер - ЕКАТЕРИНА ЕРШОВА. Аляскинский маламут IRON ICE AMADEY MOTSART. NORDIC WINNER - Финляндия 2013! 14 декабря 2013 г., Хельсинки. Класс чемпионов, CACIB, Sert, ЛУЧШИЙ КОБЕЛЬ, ВОВ, Nordic Winner. Судья - Nikos Vazakas, Greece. Хендлер - ЕКАТЕРИНА ЕРШОВА. И IRON ICE AVALANZH.
alaskamalamute.com
De Alaska Malamute - Home
Pampa training november 2012. Dassc infoweekend Kuinderbos 2012. Onze buiten kennel in aanbouw. Nala vs Timmiq 2012. Wandeling Rotterdam 10 maart 2012. Ikay and Inuq ouders van Una. Create a free website. Start your own free website. A surprisingly easy drag and drop site creator. Learn more.
Аляскинский маламут Байрак Азскас Туран
Маламут слишком хорошая порода, чтобы вносить какие-либо изменения. В их природную многовековую адаптацию. Наши усилия должны быть направлены. Не только на выведение красивых собак, но и на сохранение физических. Возможностей, присущих собакам, найденым в свое время на Аляске. Предлагается для вязки молодой перспективный кобель,. Живущий в г. Москве, Гранд Чемпион России в 19 месяцев! Связаться можно по телефону 8-926-680-02-56. Или отправить письмо на Почтовый ящик. Дата рождения: 17.08.2006года.
Alaskan Malamute Breeder & Puppies for Sale from KingFishers Alaskan Malamutes
PO Box 521848 Big Lake, AK 99652. Arya & Klondike puppies. Pearl & River Puppies. McKinley & Klondike Puppies. Kima & Avalanche Puppies. Nikiski & Ruckus. Bristol & River Puppies. Fun-Loving Alaskan Malamute Dogs and Puppies. We are Joshua and Jaime Hughes. We love our Mals! Our desire is to breed quality dogs and produce quality puppies. The puppies are played with constantly by family members and friends. Puppies are always so much fun! And now we spend most of our time devoted to the breed. All our pu...
Alaska malamuut, parim laste koer! Kelgukoerad ja kutsikad ootavad teid
Naturaalne gluteenivaba kunstlike lõhna- ja säilitusaineteta ainulaadne toiduvalik Küsi pakkumist! Kumba millisel juhul valida? Keila koerakrossilt tõi võidu Ulvi Lukk. Keilas traditsiooniks saanud koerakross toimus seekord 1. mail 2015. Kokku osales 32 võistlejat, neist 3 km rajal 24 ning 7 km rajal 8. Oli esindatud 3 km rajal nelja võistlejaga. Naiste arvestuses tõi võidu Ulvi Lukk. Meeste arvestuses esindas klubi Kristo Ader. Ning vaata pildialbumit Kuuksaare Kelgukoerte Klubi facebook lehel.
The Great Anchorage Alaska Online Shopping Mall
Air Taxi / Charters / Air Tours. Bear / Wildlife Viewing. Polar Bear and Whaling Tours. Kenai River Cabin Rentals. For lodging and unguided shore fishing or guided fishing packages. More Links of Interest. Alaska Internet Marketing, Inc. Serving Alaskans since 1996. The Great Alaska Shopping Mall. Anchorage is the undisputed center of goods and services for all of Alaska. In this directory. Links will provide useful information for not only Alaskans but also visitors to our great state. Buy, sell, rent).
alaskamalpracticelawyers.com - This website is for sale! - alaskamalpracticelawyers Resources and Information.
The owner of alaskamalpracticelawyers.com. Is offering it for sale for an asking price of 4888 USD! This page provided to the domain owner free. By Sedo's Domain Parking. Disclaimer: Domain owner and Sedo maintain no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo or domain owner and does not constitute or imply its association, endorsement or recommendation.
Маламуты Маунтри|Щенки маламуты Кемерово
alaskamamedicalmalpracticelawyers.com
alaskamamedicalmalpracticelawyers.com - This website is for sale! - alaskamamedicalmalpracticelawyers Resources and Information.
The owner of alaskamamedicalmalpracticelawyers.com. Is offering it for sale for an asking price of 4888 USD! This page provided to the domain owner free. By Sedo's Domain Parking. Disclaimer: Domain owner and Sedo maintain no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo or domain owner and does not constitute or imply its association, endorsement or recommendation.
