Follow the Denbighshire Archives blog for up to date news about the service
http://denbighshirearchives.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
0.2 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
3
SSL
EXTERNAL LINKS
61
SITE IP
192.0.78.13
LOAD TIME
0.203 sec
SCORE
6.2
Denbighshire Archives | Follow the Denbighshire Archives blog for up to date news about the service | denbighshirearchives.wordpress.com Reviews
https://denbighshirearchives.wordpress.com
Follow the Denbighshire Archives blog for up to date news about the service
denbighshirearchives.wordpress.com
Llangollen International Musical Eisteddfod | Denbighshire Archives
https://denbighshirearchives.wordpress.com/2015/07/03/llangollen-international-musical-eisteddfod
Follow the Denbighshire Archives blog for up to date news about the service. Laquo; The Tree of Health and Happiness; The Tree of Misery and Death. Cataloguing update- August 2015. Llangollen International Musical Eisteddfod. The Llangollen International Musical Eisteddfod is a musical festival for international choirs and dance groups held since 1947, for a week annually in July, in Llangollen, North Wales. DD/LE/5/1/9/3 Souvenir Programme 1958. For information on the Llangollen International Musical Ei...
Denbighshire Archives | Follow the Denbighshire Archives blog for up to date news about the service | Page 2
https://denbighshirearchives.wordpress.com/page/2
Follow the Denbighshire Archives blog for up to date news about the service. June 6, 2016. Not only do we host a group volunteering session. We also have a regular group of virtual volunteers who support our service by volunteering from home. The virtual volunteers project started with a schools project. And some have joined to give something back to the archive world. 198 primary school, secondary school, college and school board catalogues. 58 parish council catalogues. We are looking to recruit new vi...
The Tree of Health and Happiness; The Tree of Misery and Death | Denbighshire Archives
https://denbighshirearchives.wordpress.com/2015/05/28/the-tree-of-health-and-happiness-the-tree-of-misery-and-death
Follow the Denbighshire Archives blog for up to date news about the service. Laquo; Online Services- Project Update May 2015. Llangollen International Musical Eisteddfod. The Tree of Health and Happiness; The Tree of Misery and Death. However the most serious problem was that during the last few decades the posters had been heavily repaired with sellotape or similar, and strips of this adhesive tape covered most of the rear surface of each. The tape had begun to oxidise, discolour and lose flexibilit...
TOTAL PAGES IN THIS WEBSITE
3
medievalparksgardensanddesignedlandscapes.wordpress.com
Medieval Parks, Gardens and Designed Landscapes | How Archaeology, History, Literature and Art can be combined to uncover the past | Page 2
https://medievalparksgardensanddesignedlandscapes.wordpress.com/page/2
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. December 13, 2014. By Spencer Gavin Smith. My Manchester Metropolitan University page: http:/ www2.mmu.ac.uk/hpp/research/current-phd-students/. Please help fund my research: http:/ www.gofundme.com/medievalgardensandparks. The cover of the ‘Plas Brynkir, Dolbenmaen’ book. Research into the park at Brynkir is important because it offers the opportunit...
medievalparksgardensanddesignedlandscapes.wordpress.com
Broadcasts | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/broadcasts
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. Smith, S. 2013. ‘Difrod Clawdd Offa’. S4C Television News. Smith, S. 2013. ‘Difrod Clawdd Offa’. Post Prynhawn, presented by Dewi Llwyd. BBC Radio Cymru. Smith, S. 2013. ‘Parc Canoloesol Brynkir’. Post Cyntaf, presented by Dylan Jones and Kate Crockett. BBC Radio Cymru. Smith, S. 2012. ‘A yw cofio suddo RMS Titanic wedi mynd yn ormodol? Smith, S. ...
medievalparksgardensanddesignedlandscapes.wordpress.com
The Revolution will be Televised | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/2013/06/16/the-revolution-will-be-televised/comment-page-1
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. The Revolution will be Televised. June 16, 2013. By Spencer Gavin Smith. Last Friday a medieval home called Sycharth made an appearance on a programme called ‘Britain’s Secret Homes’. The five part series is looking at 50 (as the title reveals) of the lesser known, but very important houses in Britain. Something which was cut from the segment was a sp...
medievalparksgardensanddesignedlandscapes.wordpress.com
Down among the Detail: Tilstock Park – Part Two | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/2015/02/09/down-among-the-detail-tilstock-park-part-two
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. Down among the Detail: Tilstock Park – Part Two. February 9, 2015. By Spencer Gavin Smith. My Manchester Metropolitan University page – which describes the aims and objectives of my PhD research:. Http:/ www2.mmu.ac.uk/hpp/research/current-phd-students/. Please help fund my research – which is just over 50% funded to date:. In order to map Tilstock Pa...
medievalparksgardensanddesignedlandscapes.wordpress.com
Bookends | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/2014/12/13/bookends
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. December 13, 2014. By Spencer Gavin Smith. My Manchester Metropolitan University page: http:/ www2.mmu.ac.uk/hpp/research/current-phd-students/. Please help fund my research: http:/ www.gofundme.com/medievalgardensandparks. The cover of the ‘Plas Brynkir, Dolbenmaen’ book. Research into the park at Brynkir is important because it offers the opportunit...
medievalparksgardensanddesignedlandscapes.wordpress.com
Way out in the Country | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/2015/01/27/way-out-in-the-country
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. Way out in the Country. January 27, 2015. By Spencer Gavin Smith. My Manchester Metropolitan University page: http:/ www2.mmu.ac.uk/hpp/research/current-phd-students/. Please help fund my research: http:/ www.gofundme.com/medievalgardensandparks. Just over 50% funded to date. My Academia.edu page: http:/ mmu.academia.edu/SpencerGavinSmith. On the 1st ...
medievalparksgardensanddesignedlandscapes.wordpress.com
Avengers Assemble…Part II | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/2014/05/11/avengers-assemble-part-ii
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. Avengers Assemble…Part II. May 11, 2014. By Spencer Gavin Smith. In 1378 a Mercenary Captain fighting in the Hundred Years War was assassinated. His name was Owain ap Thomas, and he was a Welshman fighting for the French against the English, and his assassination was ordered by the English Crown. The manor in Surrey was at Tatsfield (Latitude 51.2...
medievalparksgardensanddesignedlandscapes.wordpress.com
Park it like you stole from it… | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/2013/08/05/park-it-like-you-stole-from-it
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. Park it like you stole from it…. August 5, 2013. By Spencer Gavin Smith. The blog is a day later than usual – but that because the story of this current blog post has only just come to an end. Are excellent examples of where archaeologists working in different disciplines can assist each other in interpreting a site. By the same token, the prehistoria...
medievalparksgardensanddesignedlandscapes.wordpress.com
Adventures in Space and Time… | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/2014/05/18/adventures-in-space-and-time
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. Adventures in Space and Time…. May 18, 2014. By Spencer Gavin Smith. This week, I’ve been involved with two different groups and their respective meetings. On Monday I was showing members of. Dyddio Hen Dai Cymreig. Dating Old Welsh Houses http:/ www.datingoldwelshhouses.co.uk/index.html. Around the site of a medieval. Standing at the entrance to the ...
medievalparksgardensanddesignedlandscapes.wordpress.com
PhD Aims and Objectives | Medieval Parks, Gardens and Designed Landscapes
https://medievalparksgardensanddesignedlandscapes.wordpress.com/phd-aims-and-objectives
PhD Aims and Objectives. Medieval Parks, Gardens and Designed Landscapes. How Archaeology, History, Literature and Art can be combined to uncover the past. PhD Aims and Objectives. Produce a PhD thesis on the medieval Gardens, Parks and Designed Landscapes of North Wales and North West Shropshire. Research the known historical information on medieval gardens, parks and designed landscapes in the study area. Carry out fieldwork to identify examples which are only currently known from the historical record.
TOTAL LINKS TO THIS WEBSITE
61
denbighshire.preview.learningpool.com
Denbighshire on Learning Pool
Skip to main content. You are not logged in. ( Login. New modules will be added regularly, please visit the Learning hub e-learning site frequently to keep up to date with your learning and development. Please note do not click through module pages too quickly as this may affect your completion status. Also ensure you complete the course by using the exit button at the bottom of the module page. failure to do this may affect your completion status. Denbighshire an excellent council, close to its community.
Home - Denbighshire County Council Webcasts
Skip to Main Content. Skip to Main Menu Bar. Skip to Heading List. Skip to First Heading. Log in to Interact. Log in to Interact. Switch to en GB. Switch to en GB. Denbighshire County Council Webcasts. We are using cookies. We use cookies to help us improve this website. By continuing to use this site we assume you are giving us consent to use cookies. Find out more in our cookie policy. How do I view a webcast? Jan 2017 - 9:30 am. Dec 2016 - 9:30 am. Planning Committee 14/12/2016 9.30 am the Council...
Denbighshire County Council Emagazines
Denbighshire County Council News. Newyddion Cyngor Sir Ddinbych.
UK GO TO ™ 2007 - Denbighshire
About Us | | Denbighshire Antiques
How to find Us. Welcome to Denbighsire Antiques. One of the largest antiques showrooms in North Wales. You are sure to find something to suit your taste. and budget! We have an array of quality items ranging from very small collectibles and nostalgia, to very large items of finest quality furniture, from all eras. We have ample free parking for all size of vehicles from motor bikes to coaches available on our own forcourt. Open 6 days a week. Monday to Saturday 10.30am to 5pm.
denbighshirearchives.wordpress.com
Denbighshire Archives | Follow the Denbighshire Archives blog for up to date news about the service
Follow the Denbighshire Archives blog for up to date news about the service. Lunacy Commission Patients Admission Registers, 1846-1912. March 12, 2018. Did you know that the Lunacy Patients Admission Registers are available to search on ancestry.co.uk. You can use this index, to search for patients who were admitted to The North Wales Hospital, Denbigh between 1846 and 1912. Records relating to the Lunacy Commission can be found within the North Wales Hospital collection. To book a place. Details of the ...
denbighshirecouncilchairman.wordpress.com
Councillor Ann Davies | Council Chairman's blog
Council Chairman's blog. Events attended in December 2016. December 22, 2016. 05/12/16 Celebrate Reading Together Denbighshire Reading Mentoring Initiative 2016, Town Hall, Ruthin. A tea party was held to celebrate the reading achievements of children from various schools, they were each presented with certificates. It was great to see the children’s enthusiasm and pride in their reading achievements. Special thanks must go to Sarah Dixon and mentors for their continued support and encouragement. I was p...
denbighshirecountryside.org.uk
Denbighshire Countryside Service - Homepage
A- Decrease text size. A Standard text size. A Increase text size. Cyngor Sir Ddinbych / Denbighshire County Council. About Denbighshire Countryside Service. Denbighshire Countryside Service is a dynamic team that strives to enhance and promote the special landscape, wildlife and heritage of the County. Screening For Life Walk 01/07/2015. Denbighshire Countryside Email Newsletter. There was an error with your details, please try entering them again. Register here to receive our regular updates.
Domain name registration & web hosting from 123-reg
Skip navigation, go to page content. 123-reg, the cheapest and easiest way to get a domain name. This domain has been registered on behalf of a client by 123-reg.co.uk. If you would like to register your own domain name, visit 123-reg for domain names search and registration. Want your own website? Create a website the easy way, whatever your skill level is. With InstantSite from 123-reg you can build your perfect website in just a few clicks and get it up and running in a matter of minutes!
Denbighshire North Wales Dating
Denbighshire North Wales Dating. Welcome to Denbighshire Dating - for singles. Safe Online network for finding local singles. Thousands of users from your area are waiting to hear from you now! Instant messaging and webcam chat online. Chat, meet and date with single people near you today! If you are single, looking for love or rejoining the dating game, then this is the place to be. Chat online, make new friends, start a new relationship. Become a premium member, to access all features. Mdash; Contact Us.
denbighshiredeals.com
SOCIAL ENGAGEMENT