We offer driving lessons in Pittsburgh. Our driving school is rated #1 in Pittsburgh. We offer behind the wheel training for all ages. Please call for more information. Cindy 412-580-0027
http://www.drivingschoolspittsburgh.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
Dex Media, Inc.
Website Support
2200 West Air●●●●●●●●●●●●●PO Box 619810
DFW ●●●●port , TX, 75261-4008
US
View this contact
Dex Media, Inc.
Website Support
2200 West Air●●●●●●●●●●●●●PO Box 619810
DFW ●●●●port , TX, 75261-4008
US
View this contact
Dex Media, Inc.
Website Support
2200 West Air●●●●●●●●●●●●●PO Box 619810
DFW ●●●●port , TX, 75261-4008
US
View this contact
BUY YOUR DOMAIN
10
YEARS
4
MONTHS
23
DAYS
REGISTER.COM, INC.
WHOIS : whois.register.com
REFERRED : http://www.register.com
PAGES IN
THIS WEBSITE
5
SSL
EXTERNAL LINKS
0
SITE IP
98.129.229.213
LOAD TIME
0 sec
SCORE
6.2
Driving School | Driving Lessons | Pittsburgh PA | drivingschoolspittsburgh.com Reviews
https://drivingschoolspittsburgh.com
We offer driving lessons in Pittsburgh. Our driving school is rated #1 in Pittsburgh. We offer behind the wheel training for all ages. Please call for more information. Cindy 412-580-0027
drivingschoolspittsburgh.com
Testimonials And Picture Gallery - Cindy Cohen School Of Driving
http://www.drivingschoolspittsburgh.com/Driving-School-Gallery-McKees-Rocks-PA.html
1789 Pine Hollow Rd, McKees Rocks, PA 15136. Approved By State And Industry Associations. Testimonials And Picture Gallery. We are proud of the many public reviews our customers have left about us online after experiencing our driving lessons in Pittsburgh, PA. These are only a few. We’re just happy to have taught them to drive safely. Click any of these links to see more reviews. I had wonderful driving lessons with Freddie and Cindy. Passed my test on the first try. Recommend this driving school. I was...
International Driving License - Cindy Cohen School Of Driving
http://www.drivingschoolspittsburgh.com/international-information.html
1789 Pine Hollow Rd, McKees Rocks, PA 15136. Approved By State And Industry Associations. Website And Internet Marketing Powered By.
About us - Cindy Cohen School Of Driving
http://www.drivingschoolspittsburgh.com/Drivers-Ed-Classes-McKees-Rocks-PA.html
1789 Pine Hollow Rd, McKees Rocks, PA 15136. Approved By State And Industry Associations. James Keller Driving School was founded in 1998 to provide new drivers safe and professional driving instruction. 16 years later, we are the number 1 driving school in Fairfax County, Virginia, serving hundreds of students each year. Our fully licensed driving school is trusted by adults and teenagers alike to provide a patient, courteous, and informed driving experience. Website And Internet Marketing Powered By.
About us - Cindy Cohen School Of Driving
http://www.drivingschoolspittsburgh.com/Driving-School-About-Us-McKees-Rocks-PA.html
1789 Pine Hollow Rd, McKees Rocks, PA 15136. Approved By State And Industry Associations. James Keller Driving School was founded in 1998 to provide new drivers safe and professional driving instruction. 16 years later, we are the number 1 driving school in Fairfax County, Virginia, serving hundreds of students each year. Our fully licensed driving school is trusted by adults and teenagers alike to provide a patient, courteous, and informed driving experience. Website And Internet Marketing Powered By.
Request An Appointment - Cindy Cohen School Of Driving
http://www.drivingschoolspittsburgh.com/Driving-School-Appointment-Request-McKees-Rocks-PA.html
1789 Pine Hollow Rd, McKees Rocks, PA 15136. Approved By State And Industry Associations. We are the largest driving school in the Pittsburgh area, having taught thousands of students. Our vehicles are checked regularly, instructors have regular background checks, and the quality of education is top-notch. Founded by a Pittsburgh mom, we make no compromises when it comes to safety on the road. We look forward to hearing from you. Contact us by phone, email, or the form below today!
TOTAL PAGES IN THIS WEBSITE
5
www.drivingschoolspenzance.co.uk is not currently active
Is not currently active. Sorry, the page or site that you are looking is currently not active. If you are the owner of this website please contact info@ems-internet.co.uk. Or call 44 (0) 844 7041 612. We offer a range of affordable website design packages to suit any budget. We will design and build a professional website for your business helping to generate you more business throughout the year. Call us today to find out more. Want to sell your products online?
www.drivingschoolspenzance.mobi is not currently active
Is not currently active. Sorry, the page or site that you are looking is currently not active. If you are the owner of this website please contact info@ems-internet.co.uk. Or call 44 (0) 844 7041 612. We offer a range of affordable website design packages to suit any budget. We will design and build a professional website for your business helping to generate you more business throughout the year. Call us today to find out more. Want to sell your products online?
drivingschoolsperth.com.au
The Sponsored Listings displayed above are served automatically by a third party. Neither the service provider nor the domain owner maintain any relationship with the advertisers. In case of trademark issues please contact the domain owner directly (contact information can be found in whois).
drivingschoolsphiladelphiapapennsylvaniastickshiftclasses.com
Driving School, Driving Lessons | Pennsylvania
Where Safe Drivers Are Born Since 1976. Driving Lessons in The Delaware Valley. All PA Suburbs of Philadelphia and The Entire City. We make Driver's Ed a pleasent experience. Learning how to drive well and with confidence is an easy skill that can be taught. CONFIDENT DRIVING SCHOOL. Offers affordable and professional driving lessons that help you get your license. Learn how to drive confidently at our driving school. Us for our behind the wheel and online driver education classes. Driving You to Success.
Driving School | Driving Lessons | Pittsburgh PA
For Behind-The-Wheel Lessons, Call:. Behind The Wheel Lessons. Cindy Cohen School of Driving, LLC. Rated #1 in Pittsburgh for Behind The Wheel Lessons. Bull; Behind the Wheel Instruction. Bull; Online Theory Classes. Bull; Driver's Education Classroom. Bull; Private Tutoring for the Knowledge Test. Bull; Senior Citizen Evaluations. Bull; Defensive Driving Course. Bull; Pennsylvania Road Test. Bull; Mock Driving Test (at the DMV, in which the student will practice for the driving exam). Bull; Stow-Rocks H...
.: ComPass Driving School - Driving Schools Plymouth - Driving Lessons and Driving Courses :.
Hello and welcome to the Compass driving School website. Com'Pass is a family run school with over 25 years of experience and are Plymouth's largest independent driving school. We provide professional, friendly tuition in and around the Plymouth area. We also offer Pass Plus and Advanced Driving training for those who have already passed your test and wish to further improve on your driving skills. Designed and developed by Henderson Web Design Ltd.
Driving lessons Poole 1st 2 Hr lesson £10
Instructors Needed in Poole. Get a 2 Hour Driving Lesson in. We have been helping the good people of Poole, Canford Heath, Hamworthy and surrounding areas to drive for over 25 years. You to can discover your freedom by contacting us today. Don’t worry if you are a beginner as our instructors are used to putting people at ease and planning out a course of lessons to help you pass your test with little fuss. Your instructor will take care of everything for you. You are in safe hands. The first 2 hour lesso...
Driving lessons Portsmouth 1st 2 Hr lesson £10
Driving Lessons in Portsmouth. Instructors Needed in Portsmouth. Get a 2 Hour Driving Lesson in. We have been helping the good people of Portsmouth, Chichester, Isle of Wight and surrounding areas to drive for over 15 years. You to can discover your freedom by contacting us today. We take great delight when we see our ex pupils driving confidently around Portsmouth, Chichester and Isle of Wight in their own cars. The first 2 hour lesson will only cost you 10 and you can pay this direct to your instructo...
drivingschoolspringhillflorida.com
Best Price Driving Schools
Monday - Friday 9am - 5pm EST. State Approved by DMV. Log On and Off Anytime. Live Customer Support Reps! Welcome to Driving School Spring Hill Florida. We are a local owned business that has been offering online traffic school in Hernando County. For over 20 years. You can sign up online for our Florida state approved courses and work at your own pace. We offer live customer support so if you have any questions please contact us at our local Spring Hill. Phone number which is 352-563-2922. You may need ...
Driving School in Queens, NY | Learn to Drive | 5 Hour Class
Stick Shift – Manual. Packages & Rates. Stick Shift – Manual. Packages & Rates. Stick Shift – Manual. Packages & Rates. Driving School in Queens, New York. Servicing Queens County as one of the best driving schools in Queens. We are licensed in New York State, with college trained and qualified driving Instructors. Our driving instructors are skilled and provide drivers training, in class instruction, driving lessons for teenagers, adults and senior citizens in English. CDL Training and Classes. Our Clas...
SOCIAL ENGAGEMENT