evdenevenakliyatcifirmalari.net evdenevenakliyatcifirmalari.net

evdenevenakliyatcifirmalari.net

Evden eve Nakliyat Firmaları Bir başka WordPress sitesi

No description found

http://www.evdenevenakliyatcifirmalari.net/

TRAFFIC RANK FOR EVDENEVENAKLIYATCIFIRMALARI.NET

TODAY'S RATING

> 1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

August

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Saturday

CUSTOMER REVIEWS

Average Rating: 3.7 out of 5 with 11 reviews
5 star
4
4 star
4
3 star
1
2 star
0
1 star
2

Hey there! Start your review of evdenevenakliyatcifirmalari.net

AVERAGE USER RATING

Write a Review

CONTACTS AT EVDENEVENAKLIYATCIFIRMALARI.NET

AVCILAR EVDEN EVE NAKLIYAT

Mehmet AYDOGAN

GULLUK MAHALLESI.YUN●●●●●●●●●●●●●●●●●●●●DIYE DUKKANLARI.NO:2

Ka●●ri , melikgazi//merkez, 38050

TR

90.3●●●●0551
90.3●●●●0149
av●●●●●●●●●●●●●@hotmail.com

View this contact

Create Account

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
2011 January 12
UPDATED
2013 December 15
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

DOMAIN AGE

  • 10

    YEARS

  • 1

    MONTHS

  • 18

    DAYS

NAME SERVERS

1
ns1.dekatekbilisim.com

CONTENT

SCORE

6.2

SCREENSHOTS
Preview of evdenevenakliyatcifirmalari.net Tablet Preview of evdenevenakliyatcifirmalari.net Mobile Preview of evdenevenakliyatcifirmalari.net
FAVICONS
    PAGE TITLE
    Evden eve Nakliyat Firmaları | Bir başka WordPress sitesi | evdenevenakliyatcifirmalari.net contacts
    <META>
    KEYWORDS
    11 information
    12 comments
    13 feedback
    14 whois
    15 promotional code
    OTHER SITES
    CONTENT-TYPE
    utf-8
    GOOGLE PREVIEW

    Evden eve Nakliyat Firmaları Bir başka WordPress sitesi

    https://evdenevenakliyatcifirmalari.net

    No description found

    TOTAL PAGES IN THIS WEBSITE

    0