Sharing my experiences, great finds, and love of life, family, friends, food & of course football
http://faithfamilyandfootball.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.9 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
6
SSL
EXTERNAL LINKS
0
SITE IP
192.0.78.13
LOAD TIME
0.949 sec
SCORE
6.2
Faith, Family, & Football | Sharing my experiences, great finds, and love of life, family, friends, food & of course football | faithfamilyandfootball.wordpress.com Reviews
https://faithfamilyandfootball.wordpress.com
Sharing my experiences, great finds, and love of life, family, friends, food & of course football
faithfamilyandfootball.wordpress.com
Festive Fall: baking, decorating, and enjoying brisk nights | Faith, Family, & Football
https://faithfamilyandfootball.wordpress.com/2011/10/03/festive-fall-baking-decorating-and-enjoying-brisk-nights
Faith, Family, and Football. Sharing my experiences, great finds, and love of life, family, friends, food and of course football. Festive Fall: baking, decorating, and enjoying brisk nights October 3, 2011. 8212; DC&ME @ 11:02 pm. It finally arrived, our first cold snap in the good ol’ Florida panhandle! Buy your season’s pumpkin from a local Pumpkin patch:. Tips to optimize your pumpkin picking experience:. Call or inquire ahead of time if there are free or low-cost hayrides at the patch. while this...
One Decade. One Day. | Faith, Family, & Football
https://faithfamilyandfootball.wordpress.com/2011/09/11/one-decade-one-day
Faith, Family, and Football. Sharing my experiences, great finds, and love of life, family, friends, food and of course football. One Decade. One Day. September 11, 2011. 8212; DC&ME @ 1:30 am. In Loving Memory of Jeffrey Randall Smith. 8220;Eternal rest grant unto them, O Lord, and let perpetual light shine upon him. May the souls of the faithful departed, through the mercy of God, rest in peace. Amen.”. Leave a Reply Cancel reply. Enter your comment here. Address never made public). RT @ marketr laura.
Here’s to 2011 | Faith, Family, & Football
https://faithfamilyandfootball.wordpress.com/2011/12/31/heres-to-2011
Faith, Family, and Football. Sharing my experiences, great finds, and love of life, family, friends, food and of course football. Here’s to 2011 December 31, 2011. 8212; DC&ME @ 1:07 pm. So here’s to 2011… Raise a glass to the past and take a sip for the future! Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. Notify me of new comments via email. Remake b...
Comfort Food on a Diet | Faith, Family, & Football
https://faithfamilyandfootball.wordpress.com/2012/01/29/comfort-food-on-a-diet
Faith, Family, and Football. Sharing my experiences, great finds, and love of life, family, friends, food and of course football. Comfort Food on a Diet January 29, 2012. 8212; DC&ME @ 8:54 pm. Skinny Chili –. 1/2lb Lean Ground Turkey. 1 Green Bell Pepper. 1 can Light Red Kidney Beans. 1 can Pinto Beans. 1 can Beans with Chili sauce (mild or hot, your choice). 3 8oz cans Tomato Sauce. 1 can Diced Tomatoes. 2-3 tbsp. Chili Powder (add more or less till optimal taste is reached). Leave a Reply Cancel reply.
A tribute to Steve Jobs | Faith, Family, & Football
https://faithfamilyandfootball.wordpress.com/2011/10/06/a-tribute-to-steve-jobs
Faith, Family, and Football. Sharing my experiences, great finds, and love of life, family, friends, food and of course football. A tribute to Steve Jobs October 6, 2011. 8212; DC&ME @ 7:28 pm. In the words of Steve Jobs:. Steve Jobs always went above and beyond. You should too. RIP Steve Jobs 1955-2011. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your Twitter account. ( Log Out. Remake b...
TOTAL PAGES IN THIS WEBSITE
6
Faith Family and Fire -
By Faith Family Fire. November 1, 2013. I love Target…hands-down my favorite place to shop. The Starbucks ladies know me by name… funny story… a few months ago I walked into Target and all the baristas were lined up at the counter; as soon as they saw me, they shouted, “Hi A! 8221; Yup, I love Target… and Starbucks. Best part is, with my Red Card, I get 5% off Starbucks, too. Oh, and the cashiers, they know me by name, too … and my kids! And were only $1.88 for the pack of 12! By Faith Family Fire. There...
Faith, Family, & Focaccia | A faith and culture Mommy blog, because real life gets all mixed together like that.
Faith, Family, and Focaccia. A faith and culture Mommy blog, because real life gets all mixed together like that. October 14, 2017. By Serena Gideon Rice. Poem: A Deeper Voice. My voice is getting deeper. I am learning to give it time to rise up from the depths,. To speak with the sonorous reverberations of reflection and experience. It used to come more quickly,. To beat staccato rhythms on the surface of my life,. Tap-dancing with a light and pretty step,. Meant to impress, entrance the audience,.
faithfamilyandfood.blogspot.com
Faith, Family and Food
Faith, Family and Food. Celebrating the life that God has blessed me with and all the precious moments He brings. Monday, January 24, 2011. Its a New Year! I thought I would share one of our family's favorite birthday breakfasts. It is the one I serve my husband every year on his birthday for breakfast. It is special occasion worthy, but easy and quick enough for any day! Bananas Foster French Toast. Bananas Foster French Toast:. 2 bananas sliced into rounds, save 1/2 of one to the side. Mix the above in...
Faith, Family & Food
Faith, Family and Food. I’m super excited that it’s starting to get cool outside because that means I can start making recipes like this one! It just might be the best thing i’ve ever made (that doesn’t contain chocolate… obviously). Crock Pot Turkey Chili. 1 lb 99% lean ground turkey. 1 medium onion, minced. 1 red bell pepper, diced fine (I left this out because I forgot it at the store and mine turned out fine). 1 garlic clove, minced. 1 ½ cups frozen corn kernels. 10 oz can Rotel Mild Tomatoes. Add 1 ...
faithfamilyandfootball.wordpress.com
Faith, Family, & Football | Sharing my experiences, great finds, and love of life, family, friends, food & of course football
Faith, Family, and Football. Sharing my experiences, great finds, and love of life, family, friends, food and of course football. Comfort Food on a Diet. January 29, 2012. 8212; DC&ME @ 8:54 pm. Skinny Chili –. 1/2lb Lean Ground Turkey. 1 Green Bell Pepper. 1 can Light Red Kidney Beans. 1 can Pinto Beans. 1 can Beans with Chili sauce (mild or hot, your choice). 3 8oz cans Tomato Sauce. 1 can Diced Tomatoes. 2-3 tbsp. Chili Powder (add more or less till optimal taste is reached). January 23, 2012. 1 1/2 c...
faithfamilyandfrenchfries.blogspot.com
Faith, Family & French Fries
Tuesday, September 10, 2013. Cinnamon Apple Cider Jelly. We love jams and jellies at our house and because we are surrounded by great berries where we live and great tree fruits across the mountains, we have ample opportunity to make LOTS of homemade jam. Seriously, I think I'm up to 60 jars now. My minions love peanut butter and jelly sandwiches (still! But I'm looking forward to making more with apple cider pressed at a friend's farm. Yum-my! I found the recipe HERE. Cinnamon Apple Cider Jelly. Add the...
faithfamilyandfriends-lyndsay.blogspot.com
Faith, Family & Friends
Faith, Family and Friends. Tuesday, June 4, 2013. My first cousin Hunter graduated from high school this past weekend. Hunter happens to be one of Gus' top 5 favorite people! It could be because Hunter is a football and baseball superstar, or that he gets to drive tractors for Papa but I suspect it has to do with all of the attention he gets from him! Hunter never fails to take time with Gus and I just love him all the more for it! I'm pretty excited that it's not too far from the Great Smoky Mountains :).
Faithfamilyandfriends.info
This Domain Name Has Expired - Renewal Instructions.
Welcome - Faith Family and Friends
Welcome - Faith Family and Friends. Faith, Family and Friends. Faith Family and Friends is an Indianapolis Community Outreach Non-profit Organization in honor and memory of. To continue her legacy of caring for and giving to others. 2017 Save the Date. You are viewing the text version of this site. To view the full version please install the Adobe Flash Player and ensure your web browser has JavaScript enabled. You need Flash to use this feature.
faithfamilyandfriendsweekend.com
www.faithfamilyandfriendsweekend.com
This Web page parked FREE courtesy of LYNX Technology Development. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $9.95/mo. Call us any time day or night .
SOCIAL ENGAGEMENT