littlemisssouthern.blogspot.com
littlemisssouthernTemplate Simple. Diberdayakan oleh Blogger.
http://littlemisssouthern.blogspot.com/
Template Simple. Diberdayakan oleh Blogger.
http://littlemisssouthern.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
0.1 seconds
16x16
32x32
64x64
128x128
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
60
SITE IP
173.194.46.106
LOAD TIME
0.125 sec
SCORE
6.2
littlemisssouthern | littlemisssouthern.blogspot.com Reviews
https://littlemisssouthern.blogspot.com
Template Simple. Diberdayakan oleh Blogger.
Kissable Kels: January 2011
http://kissablekelly.blogspot.com/2011_01_01_archive.html
Tuesday, January 18, 2011. It has been soooo long since I last blogged. I REALLY need to get back in the groove. So much has happened since I last updated: I moved 800 miles to Austin, my niece Kalyn was born and I finally reached my first weight loss goal! I moved to Austin just over three months ago. Work is going well and I'm having a blast with my boyfriend Patrick. Kalyn Ann Kenney was born on December 1st, 2010. It took me a year but I finally lost 30 pounds! Subscribe to: Posts (Atom). Cheap Healt...
Kissable Kels: Holy Moley
http://kissablekelly.blogspot.com/2011/05/holy-moley.html
Monday, May 23, 2011. July 24, 2009. April 22, 2011. It's almost been 2 years since we first started hanging out :-). And thank God I shed that awful weight. Woot! PS Mauri will be here on Friday, rejoice! Subscribe to: Post Comments (Atom). A 25 year old woman figuring out life one day at a time. View my complete profile. 4 Hats and Frugal. Brandon Goes To Hollywood. Cheap Healthy Good - Frugal Recipes, Food Tips, No Mayo. Keeping it Classy OOTD. J Kaye's Book Blog. Bucket List to 30. I RUN 4 RON.
Lovely Tonight: July 2009
http://lovelytonight.blogspot.com/2009_07_01_archive.html
And you would be the last thing I saw coming, I'm still surprised." Joshua Radin. Thursday, July 16, 2009. I survived my Bachelorette Party (barely) and we closed on the house on Monday! We won't have internet or cable at the house until Friday so blogging will be very sparce until then. Watching continuous Friends DVDs is about the only form of entertainment we have right now! But when I return I will have a plethera of posts with tons of pictures! Links to this post. Thursday, July 9, 2009. I'll be hon...
Lord, Beer Me Strength...: August 2009
http://jessdoss.blogspot.com/2009_08_01_archive.html
Wednesday, August 5, 2009. Ace Lefty and his Time Machine. This post is not a very fun one, but I just wanted to give an update on how things are going with my dad. He was scheduled for the shunt surgery last Friday (7/31) and everything seemed to go fine. They kept him overnight and said he would be released to go home on Saturday. The nurses told us he decided to sleep on the floor that night too! He told them "it is more comforable down here! Thank you so much for the prayers! Lord, Beer Me Strength.
Lord, Beer Me Strength...: July 2009
http://jessdoss.blogspot.com/2009_07_01_archive.html
Monday, July 6, 2009. I also forgot that children have the ability to ask an unlimited amount of questions.and only a 30-second memory to go along with it! Here are a few pics of these precious gems. He looked a little too real.the tatts were really a nice touch. I mean, if that doesn't scream "I'm in love! I don't know what does. Short one today- that's all for now! Subscribe to: Posts (Atom). Lord, Beer Me Strength. She wants it, she wants it! Kids say the darndest things. My Blog is Messed Up.
three-seventeen-twelve.blogspot.com
Musings of a Mrs: June 2011
http://three-seventeen-twelve.blogspot.com/2011_06_01_archive.html
Wednesday, June 29, 2011. What I'm Loving Wednesday. Here is what I'm loving this week:. 1 I'm loving these chalk glasses. 2 I'm loving the back to this wedding dress. 3 I'm loving these monogrammed suspenders. 4 I'm loving that we are off to NY for the 4th to see my family and some friends. 5 As always, I'm loving my fiance! Have a good Wednesday everyone! Posted by Stefanie @Three-seventeen. Tuesday, June 28, 2011. And I thought Penny's haircut was bad! Posted by Stefanie @Three-seventeen. On Saturday,...
three-seventeen-twelve.blogspot.com
Musings of a Mrs: July 2011
http://three-seventeen-twelve.blogspot.com/2011_07_01_archive.html
Friday, July 29, 2011. Sorry for the delayed post. Last night we went to Holland House, a restaurant/bar with tons of different drink options. I had white sangria and it was so refreshing on a hot day. Here is a great white sangria recipe. Enjoy your weekend! 1 Bottle of Pinot Grigio wine. 4 shots (or 6 lol) of brandy. 2 ripe peaches, sliced. 1 lemon, sliced. 1 orange, sliced. 1 pint of blueberries. 1 bottle of soda water as a topper. Posted by Stefanie @Three-seventeen. Monday, July 25, 2011. The rest o...
three-seventeen-twelve.blogspot.com
Musings of a Mrs: May 2012
http://three-seventeen-twelve.blogspot.com/2012_05_01_archive.html
Wednesday, May 30, 2012. Today is going to be a random mix of things going on because I have been way too busy lately and managed to take no photos this weekend! We had a going away bbq for a friend on Friday who is moving to Atlanta. I love that the weather has been cool enough at night to have a bbq, but hot enough during the day to get a tan! We also went canoeing with a huge group. It was some much needed fun in the sun! We of course finished up Monday night with the Bachelorette! We started off with...
three-seventeen-twelve.blogspot.com
Musings of a Mrs: September 2011
http://three-seventeen-twelve.blogspot.com/2011_09_01_archive.html
Wednesday, September 28, 2011. What I'm Loving Wednesday. This week I'm back to sharing my Wednesday loves:. 1 I'm loving this BHLDN dress. It would be perfect for a Vanderbilt tailgate! 2 I'm loving Fall television shows! Some of my favorites that debuted this week are:. I love this new show! 3 I'm loving that Blake and I are going on a surprise weekend trip! Can't wait to see what my creative fiance had planned! 4 I'm loving our dog Penny who doesn't get far as much love on this blog as she should.
three-seventeen-twelve.blogspot.com
Musings of a Mrs: February 2012
http://three-seventeen-twelve.blogspot.com/2012_02_01_archive.html
Tuesday, February 28, 2012. We had such a great weekend! One step closer to becoming a married women! Posted by Stefanie @Three-seventeen. Wednesday, February 22, 2012. We are 23 days away from the wedding and I can't believe it is coming up so quickly! This weekend we are headed to New Orleans for my Bachelorette Party! I can't wait. We have such a good group coming and each girl means so much to me. I am so lucky to have these friends to celebrate with. Left on the list to do is:. 2 Become a unit. ...
TOTAL LINKS TO THIS WEBSITE
60
Sophia Mae
Tuesday, March 20, 2007. More Pics of our Growing Girl. Mommy and Sophia Cuddling. Daddy and Sophia all Snuggles. Posted by Sophia Mae and Family. Monday, March 19, 2007. Here is the latest with Sophia. She went for her one month doctors visi a couple weeks ago and she weighed 9 pounds 2 ounces! She is definitley putting some weight on! She is six weeks now and is changing so much. Here are some new pictures of her! Posted by Sophia Mae and Family. Friday, February 16, 2007. Thursday, February 08, 2007.
littlemisssophiarae.blogspot.com
Little Miss Sophia Rae
Little Miss Sophia Rae. Monday, March 21, 2011. Smooches by Details of Merriment. Friday, October 30, 2009. I went to the pumpkin patch and I picked some pumpkins. I'm decorating them today with some special decorations, I'll be sure to post some of those pictures so you all can my masterpiece. Smooches by Details of Merriment. Wednesday, September 2, 2009. I am now 2! Happy Birthday to Me! Smooches by Details of Merriment. Friday, July 24, 2009. For my Auntie Sheryl! Smooches by Details of Merriment.
Web hosting, domain name registration and web services by 1&1 Internet
THIS DOMAIN NAME HAS JUST BEEN REGISTERED FOR ONE OF OUR CUSTOMERS! Do you need affordable web hosting or a domain name? 1&1 Internet is trusted by millions. Find out why. Offers a one-stop shop for all your domain name and web hosting needs so you can maximize your full web potential — without barriers, and without fear. Smart webmasters choose 1&1 Internet for domain name registration and hosting solutions. All-Inclusive Hosting Plans with NO Hidden Charges. 24/7 Phone and E-mail Support.
littlemisssoundshine.skyrock.com
Music Blog of LittleMissSoundShine - Muffin aime... - Skyrock.com
23/05/2009 at 9:42 AM. 23/05/2009 at 12:16 PM. Subscribe to my blog! Add to my blog. Add to my blog. I don't feel like dancin'. Add to my blog. I don't feel like dancin'. Listen to this track. Add this track to my blog. I don't feel like dancin'. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.4) if someone makes a complaint. Please enter the sequence of characters in the field below. Post to my blog.
Blog de littlemisssourire - Il suffit d'elles... - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Il suffit d'elles. La sagesse c'est d'avoir des rêves suffisamment grands pour ne pas les perdre de vue lorsqu'on les poursuit. Mise à jour :. Abonne-toi à mon blog! 9829; Little Sister ♥. E used to say. E used to think. Nothing, was every bitter. Oday, i break, my promises. To stay out of the emptyness. Oday let's make our promises. E used to play. Where no one's the winner. E used to lie. Some live in better. Oday i break my promises. E used to swear. Retap...
littlemisssoutherncharm.blogspot.com
The Domestic Barbie
Little Miss Southern Charm. Monday, January 20, 2014. This blog has been moved to http:/ siers9.wix.com/thedomesticbarbie. Subscribe to: Posts (Atom). This blog has been moved to http:/ siers9.wix.com/. There was an error in this gadget. Picture Window theme. Powered by Blogger.
littlemisssouthernlove.tumblr.com
littlemisssouthernlove
littlemisssouthernloves.blogspot.com
Little Miss Southern Loves
Subscribe to: Posts (Atom). View my complete profile.
littlemissspankypantsarchive.tumblr.com
Little Miss Spanky Pants Archive
See, that’s what the app is perfect for. Wahhhh, I don’t wanna. Little Miss Spanky Pants Archive. A collection of photos and videos from the defunct Little Miss Spankypants Tumblr. Original Description: "a good little girlfriend who sometimes gets big spankings. 18 NSFW". My naughty little girlfriend got herself a pink bottom for a perfectly good - but also perfectly avoidable - reason. The caption explains…). Call me crazy but there are times when I think she’s turned on by being taken in hand. For now,...
