The Cornerstone Group, LLC is a full service tax, accounting, Certified Public Accounting Firm located in Bear, Newark, Delaware and Gap, Pennsylvania.
http://www.newarkdelawarecpa.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
The Cornerstone Group
wendy hassiepen
39 ma●●●●●n way
b●r , Delaware, 19701
United States
View this contact
The Cornerstone Group
wendy hassiepen
39 ma●●●●●n way
b●r , Delaware, 19701
United States
View this contact
The Cornerstone Group
wendy hassiepen
39 ma●●●●●n way
b●r , Delaware, 19701
United States
View this contact
BUY YOUR DOMAIN
16
YEARS
3
MONTHS
0
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
0
SITE IP
10.0.0.40
LOAD TIME
0 sec
SCORE
6.2
Delaware, CPA / Cornerstone Group, LLC, Newark Delaware Tax Preparation, Newark Delaware CPA | newarkdelawarecpa.com Reviews
https://newarkdelawarecpa.com
The Cornerstone Group, LLC is a full service tax, accounting, Certified Public Accounting Firm located in Bear, Newark, Delaware and Gap, Pennsylvania.
newarkdelawarecpa.com
Delaware, CPA / Cornerstone Group, LLC, Newark Delaware Tax Preparation, Newark Delaware CPA
http://www.newarkdelawarecpa.com/newsletter.php
Tax Preparation and Tax Planning. Tax Audits and Notices. Certified Quickbooks Pro Advisors. Buy QuickBooks and Save. Today's News and Weather. Tax Due Date Reminders. IRS Tax Forms and Publications. Marginal and Effective Tax Rates Calculator. Our regularly updated newsletter provides timely articles to help you achieve your financial goals. Please come back and visit often. Seven Common Small Business Tax Misperceptions. Five Ways to Improve Your Financial Situation. Tax-Free Savings for College. The o...
Delaware, CPA / Cornerstone Group, LLC, Newark Delaware Tax Preparation, Newark Delaware CPA
http://www.newarkdelawarecpa.com/newbizformation.php
Tax Preparation and Tax Planning. Tax Audits and Notices. Certified Quickbooks Pro Advisors. Buy QuickBooks and Save. Today's News and Weather. Tax Due Date Reminders. IRS Tax Forms and Publications. Marginal and Effective Tax Rates Calculator. Thinking of owning your own business? An action plan is needed to fulfill your dream of being your own boss and running a successful business. We help you avoid the common pitfalls that many new small business owners make when starting their new venture.
Delaware, CPA / Cornerstone Group, LLC, Newark Delaware Tax Preparation, Newark Delaware CPA
http://www.newarkdelawarecpa.com/qbsetup.php
Tax Preparation and Tax Planning. Tax Audits and Notices. Certified Quickbooks Pro Advisors. Buy QuickBooks and Save. Today's News and Weather. Tax Due Date Reminders. IRS Tax Forms and Publications. Marginal and Effective Tax Rates Calculator. Although QuickBooks is designed for the layman to understand, the initial setup and installation must be done correctly in order for future information to be accurate. Which accounting method will you use? What chart of accounts do you need for your business?
Delaware, CPA / Cornerstone Group, LLC, Newark Delaware Tax Preparation, Newark Delaware CPA
http://www.newarkdelawarecpa.com/buyqb.php
Tax Preparation and Tax Planning. Tax Audits and Notices. Certified Quickbooks Pro Advisors. Buy QuickBooks and Save. Today's News and Weather. Tax Due Date Reminders. IRS Tax Forms and Publications. Marginal and Effective Tax Rates Calculator. Buy QuickBooks and Save. You can purchase the most recent version of QuickBooks at a savings of up to 20%. By clicking on the QuickBooks graphic directly below this paragraph. QuickBooks Retail: Point of Sale. QuickBooks Premier: Contractors Edition. Now, easier t...
Delaware, CPA / Cornerstone Group, LLC, Newark Delaware Tax Preparation, Newark Delaware CPA
http://www.newarkdelawarecpa.com/dailynews.php
Tax Preparation and Tax Planning. Tax Audits and Notices. Certified Quickbooks Pro Advisors. Buy QuickBooks and Save. Today's News and Weather. Tax Due Date Reminders. IRS Tax Forms and Publications. Marginal and Effective Tax Rates Calculator. Please take a look at today's top news stories and weather. Clicking on the news categories below displays the latest up-to-the-minute headlines. To learn a little more about us please take a look at our People Page. 273 E Main Street - Newark, DE 19711.
TOTAL PAGES IN THIS WEBSITE
20
Newark, Delaware (DE) Hotels, Homes, and Jobs
HOTELS REAL ESTATE JOBS. Admin and Clerical Jobs. Sales and Marketing Jobs. Find Newark Delaware Hotels, Real Estate, Job Listings, and much more local information on this city guide. Welcome to Newark, DE. Top 3 Jobs in Newark. Kforce Finance and Accounting. Executive Assistant to the President. Austal USA, LLC. CLARION HOTEL THE BELLE. Hotel rate starting at just $74. DAYS INN NEWARK DELAWARE. Hotel rate starting at just $53. BAYMONT INN and SUITES NEWARK AT UNIVERSITY OF DELAWARE. View All Newark Jobs.
Newark Delaware
Information about Newark Delaware: restaurants, pubs, housing, business, government, sports, schools, life, Main Street, etc. A website created by GoDaddy’s Website Builder.
Newark Delaware Jobs
City, state, country. Job title, keywords. View All Jobs (. Experienced Sales Representative - Newark, DE. Senior Tolling Program Manager. Sunglass Hut - Sales Associate. Full Stack Java Software Engineer. Inside Sales Commercial Door. Seasons Hospice and Palliative Care. School Assistance Advisor II. Branch Manager Sr (MLO). Practice Solutions Approval Officer II. Retail Sales - Fragrances, Part Time: Christiana. Robert Half Office Team. Compliance Associate - AML Investigations. Newark, DE (1,131).
newarkdelaware.org - This website is for sale! - newarkdelaware Resources and Information.
The owner of newarkdelaware.org. Is offering it for sale for an asking price of 749 USD! This webpage was generated by the domain owner using Sedo Domain Parking. Disclaimer: Sedo maintains no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo nor does it constitute or imply its association, endorsement or recommendation.
Newark Delaware
Information about Newark Delaware: restaurants, pubs, housing, business, government, sports, schools, life, Main Street, etc. A website created by GoDaddy’s Website Builder.
Delaware, CPA / Cornerstone Group, LLC, Newark Delaware Tax Preparation, Newark Delaware CPA
Tax Preparation and Tax Planning. Tax Audits and Notices. Certified Quickbooks Pro Advisors. Buy QuickBooks and Save. Today's News and Weather. Tax Due Date Reminders. IRS Tax Forms and Publications. Marginal and Effective Tax Rates Calculator.
newarkdelawarecriminaldefenselawyer.com
Newark, Delaware Criminal Law Attorney Blog | Wilmington Criminal Defense Lawyer | Delaware Domestic Violence Law Firm
Make a Payment: MasterCard Visa AmEx Discover Bank. Newark, Delaware Criminal Law Blog. Authorities make arrest in Wilmington boat theft. On behalf of Law Offices of Francis E. Farren, Esq., P.A. posted in Criminal Defense. On Friday, March 2, 2012. A 38-year-old Wilmington man is in hot water with Delaware authorities. The man was arrested last week on a number of charges, some of which related to an alleged theft of a watercraft owned by the state. Comments: Leave a comment. On Friday, February 24, 2012.
Welcome newarkdelawaredentist.net - BlueHost.com
Web Hosting - courtesy of www.bluehost.com.
NewarkDelawareDirect.info - When you want to know Newark, Delaware
Find out more 1-866-445-9004. HOW WE DO IT. Software as a Service. Sign Up FREE Trial. By creating an account. Use your e-mail address. We've been proudly serving businesses and organizations just like yours. Already a Business Member? Click here to sign in. And join our growing community of. By registering I agree to accept and adhere to the terms of service. And the privacy policy. As well as to receive e-mail (which can be fully configured after sign up). Add a Brands Page. Add a Products Page. For ph...
Home
640 South College Avenue. Newark, DE 19713. Click Here to learn more about our company! Our people are at the core of our success! Hampton Inn and Suites. 1008 Old Churchmans Road. Newark, DE 19713. 654 South College Avenue. Newark, DE 19713. Find out why we are a leader among the hospitality industry! Our Virtuous Cycle is a one of a kind approach to hospitality management, which makes our associates our top priority! Click here to Apply. Select location: Newark, DE).
NDH Business Studies - Sharing the latest business studies
Sharing the latest business studies. Three Success Secrets Of The Most Successful Home Businesses. How Most Successful Home Businesses Achieve (And Maintain) Success. 1 Create A Plan. 2 Do Your Research. May 12, 2015. No Comments on Three Success Secrets Of The Most Successful Home Businesses. Choosing a Business Banking Provider. Compare several banks to see what they have to offer. Check out the terms for business loans and deposits. Loans may take the form of an overdraft or term loans. Nu...Look for ...
