rosemarywhittaker.wordpress.com
Obsolete Vernacular | An author's blogAn author's blog
http://rosemarywhittaker.wordpress.com/
An author's blog
http://rosemarywhittaker.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.7 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
6
SSL
EXTERNAL LINKS
44
SITE IP
192.0.78.13
LOAD TIME
0.702 sec
SCORE
6.2
Obsolete Vernacular | An author's blog | rosemarywhittaker.wordpress.com Reviews
https://rosemarywhittaker.wordpress.com
An author's blog
rosemarywhittaker.wordpress.com
rjwhittaker | Obsolete Vernacular
https://rosemarywhittaker.wordpress.com/author/rjwhittaker
An author's blog. April 7, 2016. My latest novel is finished. Here is the prologue and first chapter. After years of estrangement, three siblings meet to clear the family home. The novel looks at the effect upon each of them of one traumatic childhood event. They … Continue reading →. Pom Pom the Great. November 2, 2015. Originally posted on Obsolete Vernacular. Pom Pom is finally available to read. Who is he? When summer seems to be the hardest word. June 13, 2015. Pom Pom the Great. June 3, 2015. Anne ...
When summer seems to be the hardest word | Obsolete Vernacular
https://rosemarywhittaker.wordpress.com/2015/06/13/when-summer-seems-to-be-the-hardest-word-2
An author's blog. Pom Pom the Great. Pom Pom the Great →. When summer seems to be the hardest word. June 13, 2015. Uite frankly, I have grown to hate it. Promises of keeping in touch don’t often materialise, at least in the long term, and that’s really how it should be. No one can fully establish themselves in a new life if they are always looking back to the old one. This entry was posted in Uncategorized. Pom Pom the Great. Pom Pom the Great →. When summer seems to be the hardest word. Pom Pom The Great.
Frame of Reference | Obsolete Vernacular
https://rosemarywhittaker.wordpress.com/2014/11/11/frame-of-reference
An author's blog. Writing about friends and family. Pom Pom the Great →. November 11, 2014. What draws me most is the gush of light at the far end of their cramped room. It floods through the crude window in a dazzling arc and splashes onto the floor beneath. I have never seen paint this luminous and I wander past the picture several times, hoping to catch it off guard and fathom the secret of its liquid brilliance. You are right, she is indeed very beautiful,’ he says. And we are to assume the worst?
Pom Pom the Great | Obsolete Vernacular
https://rosemarywhittaker.wordpress.com/2015/05/19/pom-pom-the-great
An author's blog. Pom Pom the Great →. Pom Pom the Great. May 19, 2015. Anne of Green Gables had one who lived in a glass bookcase. James Stewart had one in ‘Harvey’. Gerard Depardieu actually was one in ‘Bogus.’ Several of my children have had them. It’s great to have friends. They enrich every part of our lives. But what if they’re invisible? Do they exist if others can’t see them? And are they the first sign of madness? This entry was posted in Uncategorized. Pom Pom the Great →. Notify me of new comm...
Pom Pom the Great | Obsolete Vernacular
https://rosemarywhittaker.wordpress.com/2015/06/03/pom-pom-the-great-2
An author's blog. Pom Pom the Great. When summer seems to be the hardest word →. Pom Pom the Great. June 3, 2015. Pom Pom is finally available to read. Who is he? He’s the monkey who came to live with us several years ago. He is messy, unpredictable, self-centred, energetic, resourceful, over-confident and has an idiosyncratic way of wrestling with the English language. His arch enemy is a Teddy Bear, against whom he wages an unceasing and increasingly bitter war. This entry was posted in Uncategorized.
TOTAL PAGES IN THIS WEBSITE
6
outskirtsofthetwenties.wordpress.com
It Started With Harper’s Bazaar… | Outskirts of the Twenties
https://outskirtsofthetwenties.wordpress.com/2014/01/05/it-started-with-harpers-bazaar
Outskirts of the Twenties. A Terribly Sedate Affair. Gone Without A Trace. It Started With Harper’s Bazaar…. January 5, 2014. So, it started with Harper’s Bazaar…. Rather more than once they had. Thus it was that the May 1915 issue of Harper’s Bazaar, in running an advertisement that dared to mention ‘objectionable hair’ (what appallingly direct words. Bunter, ready the fainting couch! Although – wait a minute. What was it that the advert said? So much for underarm hair – but what about the legs? This wa...
Solidarity Bear – Solidarity Bear
https://solidaritybear.wordpress.com/author/solidaritybear
Discussing solidarity, social movements and social media. Some Broadcasters Ignore Us. We Need To Get Over It. June 22, 2014. June 22, 2014. What does it achieve? It sounds harsh, but some broadcasters ignore us. Let’s note it, get over it…and organise around the things we can change. 2014: a personal view on unions, activism and history. January 12, 2014. January 12, 2014. First and foremost, is the tactic (and it is a tactic not a strategy) achievable, and is there a mood for it? A key question here is...
The Pros and Cons of Writing a Novel in Present Tense | WritersDigest.com
http://www.writersdigest.com/online-editor/the-pros-and-cons-of-writing-a-novel-in-present-tense
Writer’s Digest University. Writer’s Digest Shop. Writer’s Digest Tutorials. Writer’s Digest Conference. 2nd Draft Critique Service. Get Published/Sell Your Work. Build a Platform & Start Blogging. How to Improve Writing Skills. How to Write an Article. Overcoming Writer’s Block. Haven’t Written Anything Yet. At Work on First Draft. Guide to Literary Agents. The Writer’s Dig. There Are No Rules. Writer’s Digest Annual. Writer’s Digest Annual Conference. Novel Writing Conference (LA). Tip of the Day.
New Etsy Listing For Halloween – Ruby Canoe Design
https://rubycanoe.com/2014/09/17/new-etsy-listing-for-halloween
Art, Craft, Silhouette Cameo, Etsy Tips and Lots of Random Stuff. New Etsy Listing For Halloween. September 17, 2014. Ready for Halloween. We don’t do much Halloween here in Australia, but the retail stores keep trying to make us do Halloween. But it doesn’t need to be Halloween to use these cake decorations. You should try a little something different for you next get together, it’s a riot! Sharing the love we have. You could write me a little something :) Just down there Cancel reply. October 1, 2015.
Ruby Canoe Design
https://rubycanoe.com/2015/02/22/3112
Art, Craft, Silhouette Cameo, Etsy Tips and Lots of Random Stuff. February 22, 2015. Well, it’s almost the end of the second month of the year. Time flies when you’re having fun right? Time flies even when you’re not having fun as well…it’s all relative. February is a good month for us in Australia, it means the hot weather is starting to be less than the temperature of the sun. And, with any luck we are able to venture outside (without melting) and get shit done. Yay! To go to Etsy. This paper I use is ...
May the Fourth Be With You – Ruby Canoe Design
https://rubycanoe.com/2015/05/04/may-the-fourth-be-with-you
Art, Craft, Silhouette Cameo, Etsy Tips and Lots of Random Stuff. May the Fourth Be With You. May 4, 2015. May 4, 2015. Sick of hearing about a movie that is decades old? Sick of hearing about some conflict in a galaxy far far away? Nope, neither am I! So I suppose I will inhale all that YouTube has to offer until then! MAY THE 4TH BE WITH YOU! Sharing the love we have. Return of the Jedi. 10 Tips to help your New Etsy Store grow. Who Doesn’t Love a Bug? Enter your comment here. Address never made public).
Who Doesn’t Love a Bug? – Ruby Canoe Design
https://rubycanoe.com/2015/05/07/who-doesnt-love-a-bug
Art, Craft, Silhouette Cameo, Etsy Tips and Lots of Random Stuff. Who Doesn’t Love a Bug? May 7, 2015. I grew up in the 1970’s in Australia and I was convinced that everyone’s parents had owned a VW beetle or bug at some stage in their lives. I remember being a little confused about getting the groceries out of the front of the car instead of the boot, such a novelty! I have this available in my Etsy store. Sharing the love we have. May the Fourth Be With You. Enter your comment here. You are commenting ...
Ruby Canoe – Ruby Canoe Design
https://rubycanoe.com/author/sharonkenny13
Art, Craft, Silhouette Cameo, Etsy Tips and Lots of Random Stuff. October 1, 2015. The call of my people. Decided to try a new recipe tonight, cause God knows I’ve had it up to here (I just pictured my Mum doing the action) of making the same 20 things for the last 6981 days. Time for something new, I thought. So off to Pinterest I went, found a lovely recipe for garlic Parmesan chicken and, miracle or all miracles…I had all the ingredients. Mayo, is that a hing people do? Put mayo on chicken and bake?
What To Draw and How To Draw It. – Ruby Canoe Design
https://rubycanoe.com/2015/02/11/what-to-draw-and-how-to-draw-it
Art, Craft, Silhouette Cameo, Etsy Tips and Lots of Random Stuff. What To Draw and How To Draw It. February 11, 2015. A little discovery I made on http:/ www.archive.org. So give these little beauties a shot. Just love the hummingbirds and the owls! Just love the tails on all of these bird illustrations! Things just don’t really change much, do they? Even a hundred years ago, people liked to draw owls. Ya can’t go wrong with owls, right? Whereever you are in the world, have a great day/night. May 24, 2015.
Where Is All Your Money Going? – Ruby Canoe Design
https://rubycanoe.com/2014/07/05/where-is-all-your-money-going
Art, Craft, Silhouette Cameo, Etsy Tips and Lots of Random Stuff. Where Is All Your Money Going? July 5, 2014. July 5, 2014. Well, I have been MIA from my blog lately. Had a little break. I didn’t go anywhere, but just wanted a little break from spending so much time online, you know what I mean? Don’t buy unless I really need it. Don’t buy unless it is reduced and I need it, or it is essential. Is this: know where your money is going, you earned your money, keep a hold of as much as you can. Think a...
TOTAL LINKS TO THIS WEBSITE
44
Rosemary West Photography
Black and White Photography. Baby and Child Photography. Art Photography by Rosemary West.
rosemarywestrealestateadvise.blogspot.com
Rosemary's Real Estate Advice
Rosemary's Real Estate Advice. Monday, July 23, 2012. Saturday, May 19, 2012. Remax Rosemary West Testimonial2.m4v. Remax Rosemary West Testimonial1.m4v. Saturday, April 14, 2012. Considering a High-End Home? Now is the time to buy! Considering a High-End Home? The Time is Now. Buying a luxury home requires a specific strategy, however, so before you embark on the process, consider the following:. Select the right agent. Working with an agent who is experienced and successful in the luxury home marke...
Rosemary West - Search for Properties in Naperville, IL
Please log out to access consumer Login Registration. The Rosemary West Team. 100,000 to $150,000. 150,000 to $200,000. 200,000 to $250,000. 250,000 to $300,000. 300,000 to $350,000. 350,000 to $400,000. 400,000 to $500,000. 500,000 to $600,000. 600,000 to $1 mil. Choose an exact range. Back to price list. 1,000 to 1,500. 1,500 to 2,000. 2,000 to 3,000. 3,000 to 4,000. Romeoville IL Featured Property. Romeoville IL Featured Property. Romeoville IL Featured Property. Romeoville IL Featured Property. Not f...
rosemarywhitepediatricservices.com
Rosemary White | Rosemarywhite | Pediatric PT & OT Services
Pictures of Our Clients. Individual Differences and Sensory Processing. Summer Camps - Seattle, WA. New Client Info and Forms. What you need to know. Address and Phone Numbers. Pediatric PT and OT Services - Seattle, WA. Pacific NW Pediatric Therapy - Portland, OR. Pediatric Physical and Occupational Therapy Services and Pacific Northwest Pediatric Therapy are private practices located in the greater Seattle, WA and Portland, OR areas owned and directed by Rosemary White, OTR/L.
Rosemary Whitlock
Specializing in Marriage and Couples Counselling in Fredericton New Brunswick. Rosemary Whitlock provides marriage/couples counselling to any couple seeking to change confusion and chaos to a deeper, healthier relationship. Couples learn to overcome relationship issues such as :. Communication problems or how to listen to what your partner is saying and how your partner can hear what you have to say. Trust issues, jealousy. After the affair is over.
rosemarywhittaker.wordpress.com
Obsolete Vernacular | An author's blog
An author's blog. When summer seems to be the hardest word. June 13, 2015. Uite frankly, I have grown to hate it. Promises of keeping in touch don’t often materialise, at least in the long term, and that’s really how it should be. No one can fully establish themselves in a new life if they are always looking back to the old one. Pom Pom the Great. June 3, 2015. Pom Pom is finally available to read. Who is he? Pom Pom’s very most favourite things. Pom Pom’s very most least favourite things. May 19, 2015.
Rosemary Wick Fine Art — nature+landscape+abstract+spirit figures+energy
Rosemary Wick Fine Art. Nature landscape abstract spirit figures energy. ParseInt(jQuery('#huge it current image key 1').val() - iterator 1() % data 1.length : data 1.length - 1, data 1,false,true);return false;". April 24, 2015. Making art allows the rip-roaring life force inside me to go where it goes. It’s a gift and a challenge, both laborious and transcendent. Sometimes I enter a trance-like state … [read more]. Return to top of page.
Rosemary Wilkie: author | Spiral Dynamics Integral | Ageless Wisdom | Books for children
Emily and the Angels. Rosemary Wilkie is a fully qualified psychotherapist and healer, and a teacher of heart-awakening, who writes adventure stories for children which encourage their self-awareness and spiritual development. She is also a senior practitioner of Spiral Dynamics Integral and has written extensively in this subject area, including an introductory book,. Here you can find out more about her books for children. And work with Spiral Dynamics Integral. View an archive of Rosemary's articles.
Rosemary Wilkins, RD, LD, CDE
Your Connection to Better Nutrition and Health! Is a Registered/Licensed Dietitian and Certified Diabetes Educator in private practice and offers nutrition counseling and consulting services to help both individuals and organizations achieve health and wellness goals. Her private practice provides diabetes education as well as evidenced-based Medical Nutrition Therapy to meet your nutrition assessment and counseling needs. Group classes, seminars, and workshops are also available. Sessions ma...
rosemarywilkins.net
This Web page parked FREE courtesy of Cyber Shack. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $9.95/mo. Call us any time day or night .
Rosemary Williams
The Wall of Mall (2006). Rosemary Goes to the Mall (2006-7). Self Portrait with Reagan (2007). Pitch and Roll (2006). Will be included in "Around the Table: Food, Community and Creativity" at the San Jose Museum of Art. October 24, 2013-April 20, 2014. Link to the San Jose Museum of Art. Solo exhibition "New Springfield. At the Visual Arts Gallery of the University of Illinois - Springfield. October 7 - November 14, 2013. Link to UIS Gallery. Link to the Kickstarter project page.
