Developed by: SoftLogic, Ratnagiri. The hotel was established by Mr. Kamlakar Desai and Mr. Ramakant Desai on 18th October 1982 at a central location of the city of Ratnagiri with a motto to serve our customers. We are committed to meeting and exceeding the expectations of our guests through our unremitting dedication to every aspect of service and to gratify our customers.
http://www.hotelvivek.in/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.4 seconds
PAGES IN
THIS WEBSITE
6
SSL
EXTERNAL LINKS
8
SITE IP
202.66.173.123
LOAD TIME
1.411 sec
SCORE
6.2
Welcome to Hotel Vivek, Ratnagiri. | hotelvivek.in Reviews
https://hotelvivek.in
Developed by: SoftLogic, Ratnagiri. The hotel was established by Mr. Kamlakar Desai and Mr. Ramakant Desai on 18th October 1982 at a central location of the city of Ratnagiri with a motto to serve our customers. We are committed to meeting and exceeding the expectations of our guests through our unremitting dedication to every aspect of service and to gratify our customers.
hotelvivek.in
Welcome to Hotel Vivek, Ratnagiri.
http://www.hotelvivek.in/Tariff.html
Twin sharing (bed& B∕F). Rates Including all Taxes. CHEK OUT TIME 24 HOURS). Complimentary on request pick-up service is available from Ratnagiri Railway Station and Ratnagiri Bus Stand to Hotel Vivek. Complimentary on request pick-up service only at the time of arrival of guest. Complimentary on request pick-up service is applicable only in case of confirm bookings. Complimentary on request pick-up service is applicable only in case of inform our booking representative before 24Hrs of arrival.
Welcome to Hotel Vivek, Ratnagiri.
http://www.hotelvivek.in/Services.html
Right, as you walk into our lobby you will feel the overwhelming warmth. The attention to the finest details has given us this immense goodwill that we enjoy! It makes us really proud when our guests come back to us - simply on the basis of the excellent service that they have received - Service that delivers much more than is promised. We have a wide variety of rooms to suit every traveler's need and budget. Have a look at our luxurious and well laid out rooms. A C Banquet Hall. Delicious Vegetarian as ...
Welcome to Hotel Vivek, Ratnagiri.
http://www.hotelvivek.in/Facilities.html
A range of accommodations are available as follows. Travel service assistance for guests.
Welcome to Hotel Vivek, Ratnagiri.
http://www.hotelvivek.in/Location.html
Quick review of Place, Ratnagiri. Ratnagiri is situated at coastal region of Maharashtra state with God’s gifted natural beauty and resources. It’s at a distance of 370 kms by road (approx.) from Mumbai (capital of Maharashtra) towards Goa. National higway number 17 is passing from Ratnagiri. Even it’s connected to Mumbai by Konkan Railway. From Pune Ratnagiri is at 350 kms by road (approx.). The narrow streets of all the small villages lined with Konkani style cottage, with sloping red-tile roofs immedi...
Welcome to Hotel Vivek, Ratnagiri.
http://www.hotelvivek.in/Index.html
Developed by: SoftLogic, Ratnagiri. The hotel was established by Mr. Kamlakar Desai and Mr. Ramakant Desai on 18th October 1982 at a central location of the city of Ratnagiri with a motto to serve our customers. We are committed to meeting and exceeding the expectations of our guests through our unremitting dedication to every aspect of service and to gratify our customers.
TOTAL PAGES IN THIS WEBSITE
6
Ratnagiri TOURISM: Hotels in Ratnagiri
http://ratnagiritourism.blogspot.com/p/hotels-in-ratnagiri.html
Welcome to most popular Konkan Tourism blog! BUY PROPERTY IN KONKAN. List prepared by Saraswat Mitra Magazine. Saraswat Mitra do not endorse any of the mentioned hotel. This list is given for information only. Customers are requested to confirm the quality and other issues. We do not take any responsibility for the same. Hotel owners may contact us at saraswatmitra@gmail.com. For any addition or deletion in the list below.). 540 B/1, Main Road, Ganapatipule, Ratnagiri, Maharashtra, 415622. Hotel Landmark...
Ratnagiri Hotels
http://www.ratnagiriinfo.com/Index/Hotels.html
Hotel Saraswati - Chiplun. Karanjkar Center, Bahadurshaikh Naka, Mumbai – Goa Highway, Tal. Chiplun, Dist. Ratnagiri. Maharashtra, India. 02355-255534, Cell. 9028295534. Aamrai Agro Tourism - Pawas - Purnagad. Shree Siddheshvar Krushi Paryatan Kendra, At.Post.- Purnagad, Tal.Dist.- Ratnagiri. Barve Homes - Home Stay - Ganpatipule - Ratnagiri. Mrs Mrunal Barve, ‘Amod’, Gaiwadi, Shirgaon, Ratnagiri 415 629 – Maharashtra – India. Yashwant Niwas - Ganpatipule. Hotel Shree Sagar - Ganpatipule. House No.30...
Welcome to Ratnagiri District. ..Ratnagiri district is a paradise in the world
http://www.ratnagiriinfo.com/Index.html
Javascript DHTML Image Web Scroller Powered by dhtml-menu-builder.com. BSNL Mobile Landline Bill. Vehicle Buy/Sale and Rent. Computer Sales and Service. Printer Sales and Service. K S Powar Builders and Developers. Aamrai Agro Tourism - Pawas - Purnagad. Hotel Saraswati - Chiplun. Rajapur - 3 acre 20 Guntha Valued Property (Private Sale). Valued Property, 10 Acre @ Kelye-Ambekond, Ratnagiri. Rajapur - 85 acre, 4 acre, 103 GunthaValued Property (Private Sale). Next Step-Printer Sales and Service.
Welcome to Ratnagiri Photo Gallery
http://www.ratnagiriinfo.com/Gallery/Gallery.html
Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768. Resolution: 1024 X 768.
Ratnagiri Social
http://www.ratnagiriinfo.com/Social/Index.html
Janeev Foundation, Ratnagiri. C/O Mahesh Mohan Garde. 4/400, Atharva, Ravindra Nagar, Karwanchi Wadi,. Kuwarbav, Ratnagiri, Pin - 415639. Cheentamani, Anandnagar,Thiba Palace Road, Ratnagiri. Phone No. [02352] 225430. Mr Vinay Paranjape - 9922260641. Adv Vinaya Ghag - 9822983620. MrShirish Damle - 9423875402.
Ratnagiri Computer Sales & Services
http://www.ratnagiriinfo.com/Index/Computer.html
Computer Sales and Services. INTEGRATED BUSINESS SOLUTIONS (IBS). 17/18, Vasant Vihar Complex, Maruti Mandir, Ratnagiri, Maharashtra, India. Pin: 415612. 17, Samrat Shopping Center, Maruti Mandir, Ratnagiri – 415612.
Hotels in Ratnagiri : myRatnagiri : Ratnagiri's Online Tourism Tours Travel Hotel Information Guide
http://www.myratnagiri.com/hotels.html
Book Hotel at Cheapest Price. GOA - Upto 50% Off. 7000 Hotels across India. Ratnagiri has vast list of Hotels, Accomodation and Resort from 2 Star to 5 star hotels. The rates of Hotels varies as per their status, starting from INR. 700.00 upto INR. 7000. Ratnagiri has 5 Beach Resorts with 5 Star facilities and some of them provide excursions and water sports. You can get Pick up and Drop facility with some of the hotels or by Tour Operator. Featured Hotel of the Month. Best Deal of the Month.
TOTAL LINKS TO THIS WEBSITE
8
hotelvivas.com
The domain hotelvivas.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
hotelvivawyndhamaztecarivieramaya.com
Hotel Viva Wyndham Azteca
Hotel Viva Wyndham Azteca. Tu Eliges Como Pagar Las tarifas más económicas garantizadas con las mejores opciones de pago compruébalo ya. Hotel Viva Wymdham Azteca Llama Gratis al 01-800-060-2532. Reserva del 20 de Marzo al 2 de Abril 2018 y viaja todo el año a Riviera Maya con descuentos en el Hotel Viva Wymdham Azteca y hasta 50% en Boletos de Avión. Obtén las mejores promociones en Hoteles, Viajes y Paquetes disponibles en Viajes de Semana Santa 2018. En Riviera Maya. Consigue 2 menores. Reserva el Hot...
Wyndham Hotel Loyalty Program Free travel rewards program Riviera Maya
WYNDHAM Hotels Mexico Cancun -Playa del Carmen - Queretaro - Leon Guanajauto. Wyndham Loyalty Program with Wyndham Hotels Mexico. Can't wait for Wyndham rewards? Now you don't have to. Our Wyndham deals and discounts help you rack up points quicker so you can get rewards faster and save a bundle along the way. With so many Wyndham hotels and partners to choose from, scoring deals has never been easier. Wyndham Azteca Playa del Carmen. Wyndham Maya Playa del Carmen. Wyndham Garden Barranquilla, Colombia.
hotelvivawyndhammayaplayadelcarmen.com
Hotel Viva Wyndham Maya
Hotel Viva Wyndham Maya. Tu Eliges Como Pagar Las tarifas más económicas garantizadas con las mejores opciones de pago compruébalo ya. Hotel Viva Wymdham Maya Llama Gratis al 01-800-060-2532. Reserva del 20 de Marzo al 2 de Abril 2018 y viaja todo el año a Riviera Maya con descuentos en el Hotel Viva Wymdham Maya y hasta 50% en Boletos de Avión. Obtén las mejores promociones en Hoteles, Viajes y Paquetes disponibles en Viajes de Semana Santa 2018. En Riviera Maya. Consigue 2 menores. De 12 años GRATIS.
Hotel Vivek – Business class hotel in Nilgiris
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. Guests sink into deep chairs and gaze at nature’s canopy of clear sky while we serve the most delicious range of dishes cooked with farm fresh vegetables and poultry at ‘Green Field’ our garden restaurant. Rainbow is the bar that lies above expectations with everything it offers. Our extensive range of premier brands and other divergent choice of spirits makes this place a great social hub. Travel Desk and Tourism. First of all , ...
Welcome to Hotel Vivek, Ratnagiri.
Developed by: SoftLogic, Ratnagiri. The hotel was established by Mr. Kamlakar Desai and Mr. Ramakant Desai on 18th October 1982 at a central location of the city of Ratnagiri with a motto to serve our customers. We are committed to meeting and exceeding the expectations of our guests through our unremitting dedication to every aspect of service and to gratify our customers.
Hotel Viveka | Hotels in Kurunegala | Wedding Halls in Kurunegala | Rooms in Kurunegala
T : 94 37 2222 897 Booking Request. INQUIRE FOR A RESERVATION. Welcome To Hotel Viveka. Nearly 125 year old Viveka has been restored back to its old glory by the present owners and since the late nineties she has been the home away from home with all the modern comforts to the weary traveller. ( See Facilities ) Being small you get individual attention from the staff. North Lake Road,. Kurunegala, Sri Lanka. T : 94 37 2222 897. M : 94 77 5354 866. E : info@hotelviveka.com / info@hotelviveka.com.
hotelvivek
Hotel Vivek Jammu
Hotel Vivek, Jammu is a 2 star hotel which is located amongst delightful scenery and has various facilities such as restaurant, air conditioning, availability of doctor, etc. to satisfy customers requirements. Moreover, it is located at a distance of nearly 4 kms from the railway station and 7 kms from Jammu Airport. The hotel offers 24 rooms for its guests and accommodation is provided in three categories: AC Deluxe Superior, AC Deluxe Executive, and Family Suit. Come have a Look into Our Hotel.
Hotel Vivek Plaza – Hotel in Ambala
Book Super deluxe or deluxe room and get welcome drink and complementary breakfast. Super Deluxe @ 2,199/-. Deluxe room @ 1599/-. Book Super deluxe or deluxe room and get 25% discount including complementary breakfast. Hotel Vivek Plaza, 12 Cross Road, Opposite Ambedkar Park, near Sewa Samiti School, Ambala Cantt. 133 001. Phone: 91 171 4000984, 4007117. Theme by SKT Themes.
www.hotelvivemenorcagolf.com
Está viendo este mensaje porque su navegador no soporta marcos. Visite la página de destino adecuada.
