Hotel Viveka kurunegala sri lanka Kurunegala Is the capital of the North Western Province, once in the 13th century the capital of the country for 50 yrs. 90 Kms from Colombo, 45 Kms from the airport, the town is next to a man made lake both of which are surrounded by a mountain range with eight mountains, the highest of which is
http://www.hotelviveka.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
2.2 seconds
16x16
32x32
64x64
128x128
160x160
192x192
256x256
C SOFT web Solutions
Chinthaka Fernando
# ●●49
Jayasun●●●●●●●ma Road , WP, 10390
LK
View this contact
C SOFT web Solutions
Chinthaka Fernando
# ●●49
Jayasun●●●●●●●ma Road , WP, 10390
LK
View this contact
C SOFT web Solutions
Chinthaka Fernando
# ●●49
Jayasun●●●●●●●ma Road , WP, 10390
LK
View this contact
BUY YOUR DOMAIN
12
YEARS
10
MONTHS
19
DAYS
CLOUD GROUP LIMITED
WHOIS : whois.hostingservicesinc.net
REFERRED : http://www.resell.biz
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
9
SITE IP
143.95.253.75
LOAD TIME
2.186 sec
SCORE
6.2
Hotel Viveka | Hotels in Kurunegala | Wedding Halls in Kurunegala | Rooms in Kurunegala | hotelviveka.com Reviews
https://hotelviveka.com
Hotel Viveka kurunegala sri lanka Kurunegala Is the capital of the North Western Province, once in the 13th century the capital of the country for 50 yrs. 90 Kms from Colombo, 45 Kms from the airport, the town is next to a man made lake both of which are surrounded by a mountain range with eight mountains, the highest of which is
Sri Lanka: Hotels in Sri Lanka
http://srilankadotcom.blogspot.com/p/hotels-in-sri-lanka.html
Sri lanka is one of most beautiful countries in the world. Sri lanka is an island with sandy beaches, forests, mountain, rivers, waterfalls, sanctuaries and ancient places and ruins. And Sri Lanka is a best place to travel and spend holiday peacefully. Hotels in Sri Lanka. Hotels in Sri Lanka. 231, Gall Road, Bambalapitiya, Colombo 04. 48, Janadhipathi Mawatha, Colombo. 77, Galle Road, Colombo03. 64, Lotus Road, Colombo. Galle Face Court Casa Susana. Galle Face Court 2, 4th floor, flat 50, Colombo 03.
Joomla Content Management Systems web design sri lanka
http://www.sevenlanka.com/Web-Hosting-lanka
Sri lanka JOOMLA Web Design Company portfolio. Subsidiary Of Seven Lanka Solutions. Sri lanka Wedding photography. HTML, Adobe Flash, Adobe Photoshop. Exotic lanka Travels Web Site. HTML, Adobe Photoshop. Hotel Viveka - Kurunegala. Travel and Hotel Web Site. HTML, Adobe Flash, Adobe Photoshop. Lagoonview Hotel - Moratuwa. Lagoon View Hotel Web Site. HTML, Adobe Photoshop. Saman Ashoka Professional Photography. Html, Adobe Photoshop.
Joomla Content Management Systems web design sri lanka
http://www.sevenlanka.com/Blog
Sri lanka JOOMLA Web Design Company portfolio. Subsidiary Of Seven Lanka Solutions. Sri lanka Wedding photography. HTML, Adobe Flash, Adobe Photoshop. Exotic lanka Travels Web Site. HTML, Adobe Photoshop. Hotel Viveka - Kurunegala. Travel and Hotel Web Site. HTML, Adobe Flash, Adobe Photoshop. Lagoonview Hotel - Moratuwa. Lagoon View Hotel Web Site. HTML, Adobe Photoshop. Saman Ashoka Professional Photography. Html, Adobe Photoshop.
Joomla Content Management Systems web design sri lanka
http://www.sevenlanka.com/Portfolio
Sri lanka JOOMLA Web Design Company portfolio. Subsidiary Of Seven Lanka Solutions. Sri lanka Wedding photography. HTML, Adobe Flash, Adobe Photoshop. Exotic lanka Travels Web Site. HTML, Adobe Photoshop. Hotel Viveka - Kurunegala. Travel and Hotel Web Site. HTML, Adobe Flash, Adobe Photoshop. Lagoonview Hotel - Moratuwa. Lagoon View Hotel Web Site. HTML, Adobe Photoshop. Saman Ashoka Professional Photography. Html, Adobe Photoshop.
Joomla Content Management Systems web design sri lanka
http://www.sevenlanka.com/About
Sri lanka JOOMLA Web Design Company portfolio. Subsidiary Of Seven Lanka Solutions. Sri lanka Wedding photography. HTML, Adobe Flash, Adobe Photoshop. Exotic lanka Travels Web Site. HTML, Adobe Photoshop. Hotel Viveka - Kurunegala. Travel and Hotel Web Site. HTML, Adobe Flash, Adobe Photoshop. Lagoonview Hotel - Moratuwa. Lagoon View Hotel Web Site. HTML, Adobe Photoshop. Saman Ashoka Professional Photography. Html, Adobe Photoshop.
Joomla Content Management Systems web design sri lanka
http://www.sevenlanka.com/Services
Sri lanka JOOMLA Web Design Company portfolio. Subsidiary Of Seven Lanka Solutions. Sri lanka Wedding photography. HTML, Adobe Flash, Adobe Photoshop. Exotic lanka Travels Web Site. HTML, Adobe Photoshop. Hotel Viveka - Kurunegala. Travel and Hotel Web Site. HTML, Adobe Flash, Adobe Photoshop. Lagoonview Hotel - Moratuwa. Lagoon View Hotel Web Site. HTML, Adobe Photoshop. Saman Ashoka Professional Photography. Html, Adobe Photoshop.
Joomla Content Management Systems web design sri lanka
http://www.sevenlanka.com/sitemap.html
Sri lanka JOOMLA Web Design Company portfolio. Subsidiary Of Seven Lanka Solutions. Sri lanka Wedding photography. HTML, Adobe Flash, Adobe Photoshop. Exotic lanka Travels Web Site. HTML, Adobe Photoshop. Hotel Viveka - Kurunegala. Travel and Hotel Web Site. HTML, Adobe Flash, Adobe Photoshop. Lagoonview Hotel - Moratuwa. Lagoon View Hotel Web Site. HTML, Adobe Photoshop. Saman Ashoka Professional Photography. Html, Adobe Photoshop.
TOTAL LINKS TO THIS WEBSITE
9
hotelvivawyndhamaztecarivieramaya.com
Hotel Viva Wyndham Azteca
Hotel Viva Wyndham Azteca. Tu Eliges Como Pagar Las tarifas más económicas garantizadas con las mejores opciones de pago compruébalo ya. Hotel Viva Wymdham Azteca Llama Gratis al 01-800-060-2532. Reserva del 20 de Marzo al 2 de Abril 2018 y viaja todo el año a Riviera Maya con descuentos en el Hotel Viva Wymdham Azteca y hasta 50% en Boletos de Avión. Obtén las mejores promociones en Hoteles, Viajes y Paquetes disponibles en Viajes de Semana Santa 2018. En Riviera Maya. Consigue 2 menores. Reserva el Hot...
Wyndham Hotel Loyalty Program Free travel rewards program Riviera Maya
WYNDHAM Hotels Mexico Cancun -Playa del Carmen - Queretaro - Leon Guanajauto. Wyndham Loyalty Program with Wyndham Hotels Mexico. Can't wait for Wyndham rewards? Now you don't have to. Our Wyndham deals and discounts help you rack up points quicker so you can get rewards faster and save a bundle along the way. With so many Wyndham hotels and partners to choose from, scoring deals has never been easier. Wyndham Azteca Playa del Carmen. Wyndham Maya Playa del Carmen. Wyndham Garden Barranquilla, Colombia.
hotelvivawyndhammayaplayadelcarmen.com
Hotel Viva Wyndham Maya
Hotel Viva Wyndham Maya. Tu Eliges Como Pagar Las tarifas más económicas garantizadas con las mejores opciones de pago compruébalo ya. Hotel Viva Wymdham Maya Llama Gratis al 01-800-060-2532. Reserva del 20 de Marzo al 2 de Abril 2018 y viaja todo el año a Riviera Maya con descuentos en el Hotel Viva Wymdham Maya y hasta 50% en Boletos de Avión. Obtén las mejores promociones en Hoteles, Viajes y Paquetes disponibles en Viajes de Semana Santa 2018. En Riviera Maya. Consigue 2 menores. De 12 años GRATIS.
Hotel Vivek – Business class hotel in Nilgiris
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. Guests sink into deep chairs and gaze at nature’s canopy of clear sky while we serve the most delicious range of dishes cooked with farm fresh vegetables and poultry at ‘Green Field’ our garden restaurant. Rainbow is the bar that lies above expectations with everything it offers. Our extensive range of premier brands and other divergent choice of spirits makes this place a great social hub. Travel Desk and Tourism. First of all , ...
Welcome to Hotel Vivek, Ratnagiri.
Developed by: SoftLogic, Ratnagiri. The hotel was established by Mr. Kamlakar Desai and Mr. Ramakant Desai on 18th October 1982 at a central location of the city of Ratnagiri with a motto to serve our customers. We are committed to meeting and exceeding the expectations of our guests through our unremitting dedication to every aspect of service and to gratify our customers.
Hotel Viveka | Hotels in Kurunegala | Wedding Halls in Kurunegala | Rooms in Kurunegala
T : 94 37 2222 897 Booking Request. INQUIRE FOR A RESERVATION. Welcome To Hotel Viveka. Nearly 125 year old Viveka has been restored back to its old glory by the present owners and since the late nineties she has been the home away from home with all the modern comforts to the weary traveller. ( See Facilities ) Being small you get individual attention from the staff. North Lake Road,. Kurunegala, Sri Lanka. T : 94 37 2222 897. M : 94 77 5354 866. E : info@hotelviveka.com / info@hotelviveka.com.
hotelvivek
Hotel Vivek Jammu
Hotel Vivek, Jammu is a 2 star hotel which is located amongst delightful scenery and has various facilities such as restaurant, air conditioning, availability of doctor, etc. to satisfy customers requirements. Moreover, it is located at a distance of nearly 4 kms from the railway station and 7 kms from Jammu Airport. The hotel offers 24 rooms for its guests and accommodation is provided in three categories: AC Deluxe Superior, AC Deluxe Executive, and Family Suit. Come have a Look into Our Hotel.
Hotel Vivek Plaza – Hotel in Ambala
Book Super deluxe or deluxe room and get welcome drink and complementary breakfast. Super Deluxe @ 2,199/-. Deluxe room @ 1599/-. Book Super deluxe or deluxe room and get 25% discount including complementary breakfast. Hotel Vivek Plaza, 12 Cross Road, Opposite Ambedkar Park, near Sewa Samiti School, Ambala Cantt. 133 001. Phone: 91 171 4000984, 4007117. Theme by SKT Themes.
www.hotelvivemenorcagolf.com
Está viendo este mensaje porque su navegador no soporta marcos. Visite la página de destino adecuada.
Charme e encantamento em Penedo - Hotel Vivenda Penedo - Pousada
Benvindo ao Hotel Vivenda Penedo. Fotos dos Chalés. Telefones: (24) 3351 1331 - 3351 1370. Veja as Fotos dos Chalés clique aqui. Para ver a recepção do Hotel Vivenda Penedo clique aqui. Férias de Julho. O Hotel Vivenda Penedo. Dispõe de Gerador. Buscar no Hotel Vivenda Penedo. Chalés para família. Acomodações com lareira. Informações sobre Penedo. Diárias - Tarifário. Férias de Julho. Nossa Localização. Fotos da Área Verde. Terapias: shiatsu e acupuntura. Promoção Baixa Temporada. Cadastre aqui seu e-mail.
SOCIAL ENGAGEMENT